Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 3662627..3663294 | Replicon | chromosome |
| Accession | NZ_CP106885 | ||
| Organism | Achromobacter spanius strain LIG3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N8Z00_RS16520 | Protein ID | WP_268077631.1 |
| Coordinates | 3662627..3663046 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N8Z00_RS16525 | Protein ID | WP_268077632.1 |
| Coordinates | 3663043..3663294 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8Z00_RS16495 (N8Z00_16495) | 3658381..3659340 | - | 960 | WP_268077626.1 | DMT family transporter | - |
| N8Z00_RS16500 (N8Z00_16500) | 3659422..3660291 | - | 870 | WP_268077627.1 | AraC family transcriptional regulator | - |
| N8Z00_RS16505 (N8Z00_16505) | 3660378..3661652 | - | 1275 | WP_268077628.1 | RNA polymerase sigma factor | - |
| N8Z00_RS16510 (N8Z00_16510) | 3661649..3662056 | - | 408 | WP_268077629.1 | VOC family protein | - |
| N8Z00_RS16515 (N8Z00_16515) | 3662075..3662485 | - | 411 | WP_268077630.1 | YciI family protein | - |
| N8Z00_RS16520 (N8Z00_16520) | 3662627..3663046 | - | 420 | WP_268077631.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N8Z00_RS16525 (N8Z00_16525) | 3663043..3663294 | - | 252 | WP_268077632.1 | Arc family DNA-binding protein | Antitoxin |
| N8Z00_RS16530 (N8Z00_16530) | 3663395..3663748 | - | 354 | WP_268077633.1 | YciI family protein | - |
| N8Z00_RS16535 (N8Z00_16535) | 3663912..3664895 | - | 984 | WP_268077634.1 | OmpA family protein | - |
| N8Z00_RS16540 (N8Z00_16540) | 3664892..3665791 | - | 900 | WP_268077635.1 | MotA/TolQ/ExbB proton channel family protein | - |
| N8Z00_RS16545 (N8Z00_16545) | 3666089..3668056 | + | 1968 | WP_268077636.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14660.88 Da Isoelectric Point: 4.8181
>T259933 WP_268077631.1 NZ_CP106885:c3663046-3662627 [Achromobacter spanius]
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|