Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2705726..2706321 Replicon chromosome
Accession NZ_CP106885
Organism Achromobacter spanius strain LIG3

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N8Z00_RS12205 Protein ID WP_268081866.1
Coordinates 2706139..2706321 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N8Z00_RS12200 Protein ID WP_268081865.1
Coordinates 2705726..2706115 (-) Length 130 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8Z00_RS12170 (N8Z00_12170) 2700867..2701838 + 972 WP_268081860.1 tripartite tricarboxylate transporter substrate binding protein -
N8Z00_RS12175 (N8Z00_12175) 2702006..2702956 - 951 WP_268081861.1 nitronate monooxygenase -
N8Z00_RS12180 (N8Z00_12180) 2703177..2704004 + 828 WP_268081862.1 hypothetical protein -
N8Z00_RS12185 (N8Z00_12185) 2704375..2704713 + 339 WP_268081863.1 hypothetical protein -
N8Z00_RS12190 (N8Z00_12190) 2704938..2705141 + 204 WP_172616244.1 cold-shock protein -
N8Z00_RS12195 (N8Z00_12195) 2705255..2705638 - 384 WP_268081864.1 GFA family protein -
N8Z00_RS12200 (N8Z00_12200) 2705726..2706115 - 390 WP_268081865.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N8Z00_RS12205 (N8Z00_12205) 2706139..2706321 - 183 WP_268081866.1 type II toxin-antitoxin system HicA family toxin Toxin
N8Z00_RS12210 (N8Z00_12210) 2706424..2707836 - 1413 WP_268081867.1 3-carboxy-cis,cis-muconate cycloisomerase -
N8Z00_RS12215 (N8Z00_12215) 2707858..2708436 - 579 WP_268081868.1 protocatechuate 3,4-dioxygenase subunit alpha -
N8Z00_RS12220 (N8Z00_12220) 2708440..2709141 - 702 WP_268081869.1 protocatechuate 3,4-dioxygenase subunit beta -
N8Z00_RS12225 (N8Z00_12225) 2709206..2710486 - 1281 WP_268081870.1 TRAP transporter large permease subunit -
N8Z00_RS12230 (N8Z00_12230) 2710483..2711058 - 576 WP_268081871.1 TRAP transporter small permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6728.84 Da        Isoelectric Point: 11.4487

>T259932 WP_268081866.1 NZ_CP106885:c2706321-2706139 [Achromobacter spanius]
MNSADIIKRLKADGWYLVHSVGSHHQFKHPTKRGKVTVPHPRKDLPAPTAHSILKQAGLR

Download         Length: 183 bp

Antitoxin


Download         Length: 130 a.a.        Molecular weight: 14135.17 Da        Isoelectric Point: 6.6400

>AT259932 WP_268081865.1 NZ_CP106885:c2706115-2705726 [Achromobacter spanius]
VLYLIYVHKEKGSAYGASFPDFPGCHAAATTLQELPSAAQEAVEAHFFGETQPIPSPSAPDVWMQKKAFQGGFWMLVDID
LSKVNTKAVRLNISLPENLVHRIDAVARARRLSRSAFLALAAEHEMEAA

Download         Length: 390 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References