Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2443998..2444635 | Replicon | chromosome |
Accession | NZ_CP106878 | ||
Organism | Fervidibacillus albus strain MEBiC13591 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OE104_RS11790 | Protein ID | WP_275417026.1 |
Coordinates | 2443998..2444348 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OE104_RS11795 | Protein ID | WP_275417027.1 |
Coordinates | 2444354..2444635 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OE104_RS11775 (OE104_11785) | 2440628..2441083 | - | 456 | WP_275417023.1 | SprT family protein | - |
OE104_RS11780 (OE104_11790) | 2441253..2441366 | + | 114 | WP_275417024.1 | cortex morphogenetic protein CmpA | - |
OE104_RS11785 (OE104_11795) | 2441607..2443787 | - | 2181 | WP_275417025.1 | Tex family protein | - |
OE104_RS11790 (OE104_11800) | 2443998..2444348 | - | 351 | WP_275417026.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OE104_RS11795 (OE104_11805) | 2444354..2444635 | - | 282 | WP_275417027.1 | antitoxin endoai | Antitoxin |
OE104_RS11800 (OE104_11810) | 2444781..2445932 | - | 1152 | WP_275417028.1 | alanine racemase | - |
OE104_RS11805 (OE104_11815) | 2446104..2447126 | - | 1023 | WP_275417029.1 | outer membrane lipoprotein carrier protein LolA | - |
OE104_RS11810 (OE104_11820) | 2447302..2447670 | - | 369 | WP_275417030.1 | holo-ACP synthase | - |
OE104_RS11815 (OE104_11825) | 2447764..2448366 | + | 603 | WP_275417031.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13052.16 Da Isoelectric Point: 5.1961
>T259926 WP_275417026.1 NZ_CP106878:c2444348-2443998 [Fervidibacillus albus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEDMMEKVDEALRISMGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEDMMEKVDEALRISMGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|