Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2918777..2919414 | Replicon | chromosome |
| Accession | NZ_CP106877 | ||
| Organism | Fervidibacillus halotolerans strain MEBiC13594 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OE105_RS13755 | Protein ID | WP_275420698.1 |
| Coordinates | 2919064..2919414 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OE105_RS13750 | Protein ID | WP_275420697.1 |
| Coordinates | 2918777..2919058 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OE105_RS13730 (OE105_13735) | 2914998..2915588 | - | 591 | WP_275420694.1 | rhomboid family intramembrane serine protease | - |
| OE105_RS13735 (OE105_13740) | 2915685..2916041 | + | 357 | WP_275420695.1 | holo-ACP synthase | - |
| OE105_RS13740 (OE105_13745) | 2916248..2917270 | + | 1023 | WP_275420696.1 | outer membrane lipoprotein carrier protein LolA | - |
| OE105_RS13745 (OE105_13750) | 2917474..2918625 | + | 1152 | WP_275422210.1 | alanine racemase | - |
| OE105_RS13750 (OE105_13755) | 2918777..2919058 | + | 282 | WP_275420697.1 | antitoxin endoai | Antitoxin |
| OE105_RS13755 (OE105_13760) | 2919064..2919414 | + | 351 | WP_275420698.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OE105_RS13760 (OE105_13765) | 2919670..2921835 | + | 2166 | WP_275422211.1 | Tex family protein | - |
| OE105_RS13765 (OE105_13770) | 2922115..2922660 | + | 546 | WP_275420699.1 | sigma-70 family RNA polymerase sigma factor | - |
| OE105_RS13770 (OE105_13775) | 2922653..2924170 | + | 1518 | WP_275420700.1 | hypothetical protein | - |
| OE105_RS13775 (OE105_13780) | 2924273..2924386 | - | 114 | WP_275420701.1 | cortex morphogenetic protein CmpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13036.10 Da Isoelectric Point: 5.1859
>T259925 WP_275420698.1 NZ_CP106877:2919064-2919414 [Fervidibacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDDMMEKVDESLRISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDDMMEKVDESLRISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|