Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 4531093..4531640 | Replicon | chromosome |
Accession | NZ_CP106874 | ||
Organism | Shewanella xiamenensis strain FH-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OCF84_RS19825 | Protein ID | WP_188870826.1 |
Coordinates | 4531093..4531395 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q8E8M1 |
Locus tag | OCF84_RS19830 | Protein ID | WP_011074236.1 |
Coordinates | 4531383..4531640 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCF84_RS19800 (OCF84_19820) | 4526551..4527828 | - | 1278 | WP_188870820.1 | DUF5666 domain-containing protein | - |
OCF84_RS19805 (OCF84_19825) | 4527918..4528586 | + | 669 | WP_055646990.1 | response regulator transcription factor | - |
OCF84_RS19810 (OCF84_19830) | 4528558..4529850 | + | 1293 | WP_188870822.1 | HAMP domain-containing sensor histidine kinase | - |
OCF84_RS19815 (OCF84_19835) | 4529941..4530330 | + | 390 | WP_188870824.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
OCF84_RS19820 (OCF84_19840) | 4530438..4530914 | - | 477 | WP_037423763.1 | peroxiredoxin | - |
OCF84_RS19825 (OCF84_19845) | 4531093..4531395 | - | 303 | WP_188870826.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OCF84_RS19830 (OCF84_19850) | 4531383..4531640 | - | 258 | WP_011074236.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OCF84_RS19835 (OCF84_19855) | 4531781..4532110 | - | 330 | WP_188870827.1 | hypothetical protein | - |
OCF84_RS19840 (OCF84_19860) | 4532369..4532830 | - | 462 | WP_050991324.1 | hypothetical protein | - |
OCF84_RS19845 (OCF84_19865) | 4533137..4534057 | - | 921 | WP_069453963.1 | choice-of-anchor H family protein | - |
OCF84_RS19850 (OCF84_19870) | 4534418..4534720 | + | 303 | WP_037423775.1 | peptidase M4 | - |
OCF84_RS19855 (OCF84_19875) | 4534722..4535417 | + | 696 | WP_037423778.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11846.85 Da Isoelectric Point: 4.9119
>T259924 WP_188870826.1 NZ_CP106874:c4531395-4531093 [Shewanella xiamenensis]
MAEIIWTEPALADLNDIAEYIALENIVAAKQLVQMVFAKVERLVDFPDSGRIPPELERLNYREVVVNPCRVFYKYDDEKV
RILFVMRAERDLRRFMLTKQ
MAEIIWTEPALADLNDIAEYIALENIVAAKQLVQMVFAKVERLVDFPDSGRIPPELERLNYREVVVNPCRVFYKYDDEKV
RILFVMRAERDLRRFMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|