Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 4267625..4268175 | Replicon | chromosome |
Accession | NZ_CP106874 | ||
Organism | Shewanella xiamenensis strain FH-1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | OCF84_RS18625 | Protein ID | WP_282895111.1 |
Coordinates | 4267876..4268175 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | V1DMX4 |
Locus tag | OCF84_RS18620 | Protein ID | WP_023266112.1 |
Coordinates | 4267625..4267867 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCF84_RS18595 (OCF84_18605) | 4262831..4264048 | + | 1218 | WP_282895110.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
OCF84_RS18600 (OCF84_18610) | 4264054..4264596 | + | 543 | WP_188870686.1 | hotdog family protein | - |
OCF84_RS18605 (OCF84_18615) | 4264697..4265422 | + | 726 | WP_188870684.1 | 3-ketoacyl-ACP reductase FabG2 | - |
OCF84_RS18610 (OCF84_18620) | 4265423..4266676 | + | 1254 | WP_188870682.1 | beta-ketoacyl-ACP synthase | - |
OCF84_RS18615 (OCF84_18625) | 4266687..4267430 | + | 744 | WP_188870680.1 | hypothetical protein | - |
OCF84_RS18620 (OCF84_18630) | 4267625..4267867 | + | 243 | WP_023266112.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OCF84_RS18625 (OCF84_18635) | 4267876..4268175 | + | 300 | WP_282895111.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OCF84_RS18630 (OCF84_18640) | 4269020..4269322 | - | 303 | WP_282895112.1 | hypothetical protein | - |
OCF84_RS18635 (OCF84_18645) | 4269350..4269772 | - | 423 | WP_282895113.1 | AsnC family protein | - |
OCF84_RS18640 (OCF84_18650) | 4269996..4270214 | + | 219 | WP_282895114.1 | hypothetical protein | - |
OCF84_RS18645 (OCF84_18655) | 4270428..4271003 | + | 576 | WP_282895115.1 | hypothetical protein | - |
OCF84_RS18650 (OCF84_18660) | 4271602..4272057 | + | 456 | WP_169548263.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11500.23 Da Isoelectric Point: 9.6431
>T259923 WP_282895111.1 NZ_CP106874:4267876-4268175 [Shewanella xiamenensis]
MNNKRYKLSRLAQAHLLKIKDYALQHFSESQWHKYQQSLISGLQMLADNPGLGRSCNDIYPNGFYFPIGKHTAYFTKEDD
FILIVALLGQPQLPQHHLK
MNNKRYKLSRLAQAHLLKIKDYALQHFSESQWHKYQQSLISGLQMLADNPGLGRSCNDIYPNGFYFPIGKHTAYFTKEDD
FILIVALLGQPQLPQHHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|