Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
Location | 3321834..3322503 | Replicon | chromosome |
Accession | NZ_CP106874 | ||
Organism | Shewanella xiamenensis strain FH-1 |
Toxin (Protein)
Gene name | ygfX | Uniprot ID | - |
Locus tag | OCF84_RS14640 | Protein ID | WP_257748774.1 |
Coordinates | 3321834..3322274 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | ygfY | Uniprot ID | - |
Locus tag | OCF84_RS14645 | Protein ID | WP_139122633.1 |
Coordinates | 3322255..3322503 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCF84_RS14615 (OCF84_14615) | 3317254..3317727 | - | 474 | WP_188869699.1 | SoxR reducing system RseC family protein | - |
OCF84_RS14620 (OCF84_14620) | 3317739..3318671 | - | 933 | WP_037427579.1 | MucB/RseB C-terminal domain-containing protein | - |
OCF84_RS14625 (OCF84_14625) | 3318684..3319295 | - | 612 | WP_055646699.1 | RseA family anti-sigma factor | - |
OCF84_RS14630 (OCF84_14630) | 3319337..3319915 | - | 579 | WP_037415584.1 | RNA polymerase sigma factor RpoE | - |
OCF84_RS14635 (OCF84_14635) | 3320105..3321718 | + | 1614 | WP_037415581.1 | L-aspartate oxidase | - |
OCF84_RS14640 (OCF84_14640) | 3321834..3322274 | - | 441 | WP_257748774.1 | hypothetical protein | Toxin |
OCF84_RS14645 (OCF84_14645) | 3322255..3322503 | - | 249 | WP_139122633.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OCF84_RS14650 (OCF84_14650) | 3322588..3323496 | - | 909 | WP_037415659.1 | transcriptional activator NhaR | - |
OCF84_RS14655 (OCF84_14655) | 3323591..3323977 | - | 387 | WP_037415577.1 | hypothetical protein | - |
OCF84_RS14660 (OCF84_14660) | 3323980..3325149 | - | 1170 | WP_037415576.1 | Na+/H+ antiporter NhaA | - |
OCF84_RS14665 (OCF84_14665) | 3325267..3326061 | - | 795 | WP_037415574.1 | thymidylate synthase | - |
OCF84_RS14670 (OCF84_14670) | 3326061..3326867 | - | 807 | WP_257748771.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16801.69 Da Isoelectric Point: 7.9950
>T259922 WP_257748774.1 NZ_CP106874:c3322274-3321834 [Shewanella xiamenensis]
VAELRHSFSVKASFDQRLSLVVFVCVCSTSLLLWPETDTAVLHGLRAILAVLILGFLCSQLWQLRKWHCRFELNGQGEGW
LSTGEAFHVLPRTWVTPFICLVYYQSANKLHLLSLWADMFSDTDYRHLCRLLLKVKTQAVSQHELL
VAELRHSFSVKASFDQRLSLVVFVCVCSTSLLLWPETDTAVLHGLRAILAVLILGFLCSQLWQLRKWHCRFELNGQGEGW
LSTGEAFHVLPRTWVTPFICLVYYQSANKLHLLSLWADMFSDTDYRHLCRLLLKVKTQAVSQHELL
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|