Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2995253..2995817 | Replicon | chromosome |
| Accession | NZ_CP106873 | ||
| Organism | Mycobacterium avium subsp. paratuberculosis K-10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | X7VBD8 |
| Locus tag | OBK31_RS13940 | Protein ID | WP_003875391.1 |
| Coordinates | 2995253..2995624 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7L5MGM2 |
| Locus tag | OBK31_RS13945 | Protein ID | WP_003875390.1 |
| Coordinates | 2995611..2995817 (-) | Length | 69 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBK31_RS13895 (OBK31_13895) | 2990590..2990787 | - | 198 | WP_016706054.1 | hypothetical protein | - |
| OBK31_RS13900 (OBK31_13900) | 2990905..2991588 | + | 684 | WP_003875399.1 | hypothetical protein | - |
| OBK31_RS13905 (OBK31_13905) | 2991593..2991917 | - | 325 | Protein_2743 | antibiotic biosynthesis monooxygenase | - |
| OBK31_RS13910 (OBK31_13910) | 2992328..2992852 | - | 525 | WP_033713819.1 | glycoside hydrolase | - |
| OBK31_RS13915 (OBK31_13915) | 2993009..2993362 | - | 354 | WP_003875396.1 | hypothetical protein | - |
| OBK31_RS13920 (OBK31_13920) | 2993432..2993815 | - | 384 | WP_003875395.1 | hypothetical protein | - |
| OBK31_RS13925 (OBK31_13925) | 2993882..2994280 | - | 399 | WP_003875394.1 | VOC family protein | - |
| OBK31_RS13930 (OBK31_13930) | 2994382..2994657 | - | 276 | WP_003878531.1 | hypothetical protein | - |
| OBK31_RS13935 (OBK31_13935) | 2994713..2995153 | - | 441 | WP_010949694.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
| OBK31_RS13940 (OBK31_13940) | 2995253..2995624 | - | 372 | WP_003875391.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OBK31_RS13945 (OBK31_13945) | 2995611..2995817 | - | 207 | WP_003875390.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OBK31_RS13950 (OBK31_13950) | 2995986..2996930 | - | 945 | WP_003875389.1 | HNH endonuclease signature motif containing protein | - |
| OBK31_RS13955 (OBK31_13955) | 2997130..2998203 | - | 1074 | WP_010949695.1 | redox-regulated ATPase YchF | - |
| OBK31_RS13960 (OBK31_13960) | 2998334..2999542 | + | 1209 | WP_010949696.1 | hypothetical protein | - |
| OBK31_RS13965 (OBK31_13965) | 2999566..3000564 | - | 999 | WP_003875386.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13770.14 Da Isoelectric Point: 6.6003
>T259918 WP_003875391.1 NZ_CP106873:c2995624-2995253 [Mycobacterium avium subsp. paratuberculosis K-10]
MILVDTSVWIDHLHVADKRLIEFLTNDAIGCHQMVIEELALGAIRRRADLLRLLSNLRAFPLLTHAEVLHLVECHRLWGR
GLSAIDVHLLGSVALVDGARLWTRDKNLKAAGWDVGIAIVDEL
MILVDTSVWIDHLHVADKRLIEFLTNDAIGCHQMVIEELALGAIRRRADLLRLLSNLRAFPLLTHAEVLHLVECHRLWGR
GLSAIDVHLLGSVALVDGARLWTRDKNLKAAGWDVGIAIVDEL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2WB37 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L5MGM2 |