Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2995253..2995817 Replicon chromosome
Accession NZ_CP106873
Organism Mycobacterium avium subsp. paratuberculosis K-10

Toxin (Protein)


Gene name vapC Uniprot ID X7VBD8
Locus tag OBK31_RS13940 Protein ID WP_003875391.1
Coordinates 2995253..2995624 (-) Length 124 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A7L5MGM2
Locus tag OBK31_RS13945 Protein ID WP_003875390.1
Coordinates 2995611..2995817 (-) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OBK31_RS13895 (OBK31_13895) 2990590..2990787 - 198 WP_016706054.1 hypothetical protein -
OBK31_RS13900 (OBK31_13900) 2990905..2991588 + 684 WP_003875399.1 hypothetical protein -
OBK31_RS13905 (OBK31_13905) 2991593..2991917 - 325 Protein_2743 antibiotic biosynthesis monooxygenase -
OBK31_RS13910 (OBK31_13910) 2992328..2992852 - 525 WP_033713819.1 glycoside hydrolase -
OBK31_RS13915 (OBK31_13915) 2993009..2993362 - 354 WP_003875396.1 hypothetical protein -
OBK31_RS13920 (OBK31_13920) 2993432..2993815 - 384 WP_003875395.1 hypothetical protein -
OBK31_RS13925 (OBK31_13925) 2993882..2994280 - 399 WP_003875394.1 VOC family protein -
OBK31_RS13930 (OBK31_13930) 2994382..2994657 - 276 WP_003878531.1 hypothetical protein -
OBK31_RS13935 (OBK31_13935) 2994713..2995153 - 441 WP_010949694.1 nitroreductase family deazaflavin-dependent oxidoreductase -
OBK31_RS13940 (OBK31_13940) 2995253..2995624 - 372 WP_003875391.1 type II toxin-antitoxin system VapC family toxin Toxin
OBK31_RS13945 (OBK31_13945) 2995611..2995817 - 207 WP_003875390.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OBK31_RS13950 (OBK31_13950) 2995986..2996930 - 945 WP_003875389.1 HNH endonuclease signature motif containing protein -
OBK31_RS13955 (OBK31_13955) 2997130..2998203 - 1074 WP_010949695.1 redox-regulated ATPase YchF -
OBK31_RS13960 (OBK31_13960) 2998334..2999542 + 1209 WP_010949696.1 hypothetical protein -
OBK31_RS13965 (OBK31_13965) 2999566..3000564 - 999 WP_003875386.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13770.14 Da        Isoelectric Point: 6.6003

>T259918 WP_003875391.1 NZ_CP106873:c2995624-2995253 [Mycobacterium avium subsp. paratuberculosis K-10]
MILVDTSVWIDHLHVADKRLIEFLTNDAIGCHQMVIEELALGAIRRRADLLRLLSNLRAFPLLTHAEVLHLVECHRLWGR
GLSAIDVHLLGSVALVDGARLWTRDKNLKAAGWDVGIAIVDEL

Download         Length: 372 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7231.22 Da        Isoelectric Point: 11.0634

>AT259918 WP_003875390.1 NZ_CP106873:c2995817-2995611 [Mycobacterium avium subsp. paratuberculosis K-10]
MRTTVTIDDALLAEAAELTGVTESVALLRQGLQTLVRVESARRLAALGGTDRKASVGPRRRAPADDSR

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2WB37

Antitoxin

Source ID Structure
AlphaFold DB A0A7L5MGM2

References