Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 2214877..2215541 | Replicon | chromosome |
Accession | NZ_CP106873 | ||
Organism | Mycobacterium avium subsp. paratuberculosis K-10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q73YC9 |
Locus tag | OBK31_RS10515 | Protein ID | WP_003872398.1 |
Coordinates | 2214877..2215284 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q73YC8 |
Locus tag | OBK31_RS10520 | Protein ID | WP_003872399.1 |
Coordinates | 2215281..2215541 (-) | Length | 87 a.a. |
Genomic Context
Location: 2210077..2211246 (1170 bp)
Type: Others
Protein ID: WP_003878212.1
Type: Others
Protein ID: WP_003878212.1
Location: 2213186..2214730 (1545 bp)
Type: Others
Protein ID: WP_010949452.1
Type: Others
Protein ID: WP_010949452.1
Location: 2216340..2217608 (1269 bp)
Type: Others
Protein ID: WP_003872401.1
Type: Others
Protein ID: WP_003872401.1
Location: 2211235..2211765 (531 bp)
Type: Others
Protein ID: WP_003878213.1
Type: Others
Protein ID: WP_003878213.1
Location: 2211886..2212431 (546 bp)
Type: Others
Protein ID: WP_003878214.1
Type: Others
Protein ID: WP_003878214.1
Location: 2212428..2212949 (522 bp)
Type: Others
Protein ID: WP_003878215.1
Type: Others
Protein ID: WP_003878215.1
Location: 2214877..2215284 (408 bp)
Type: Toxin
Protein ID: WP_003872398.1
Type: Toxin
Protein ID: WP_003872398.1
Location: 2215281..2215541 (261 bp)
Type: Antitoxin
Protein ID: WP_003872399.1
Type: Antitoxin
Protein ID: WP_003872399.1
Location: 2215722..2216174 (453 bp)
Type: Others
Protein ID: WP_003872400.1
Type: Others
Protein ID: WP_003872400.1
Location: 2217810..2219267 (1458 bp)
Type: Others
Protein ID: WP_003878220.1
Type: Others
Protein ID: WP_003878220.1
Location: 2219463..2220125 (663 bp)
Type: Others
Protein ID: WP_003872403.1
Type: Others
Protein ID: WP_003872403.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OBK31_RS10490 (OBK31_10490) | 2210077..2211246 | + | 1170 | WP_003878212.1 | hypothetical protein | - |
OBK31_RS10495 (OBK31_10495) | 2211235..2211765 | - | 531 | WP_003878213.1 | TetR/AcrR family transcriptional regulator | - |
OBK31_RS10500 (OBK31_10500) | 2211886..2212431 | - | 546 | WP_003878214.1 | carboxymuconolactone decarboxylase family protein | - |
OBK31_RS10505 (OBK31_10505) | 2212428..2212949 | - | 522 | WP_003878215.1 | carboxymuconolactone decarboxylase family protein | - |
OBK31_RS10510 (OBK31_10510) | 2213186..2214730 | + | 1545 | WP_010949452.1 | serine/threonine-protein kinase | - |
OBK31_RS10515 (OBK31_10515) | 2214877..2215284 | - | 408 | WP_003872398.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OBK31_RS10520 (OBK31_10520) | 2215281..2215541 | - | 261 | WP_003872399.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OBK31_RS10525 (OBK31_10525) | 2215722..2216174 | - | 453 | WP_003872400.1 | VOC family protein | - |
OBK31_RS10530 (OBK31_10530) | 2216340..2217608 | + | 1269 | WP_003872401.1 | cytochrome P450 | - |
OBK31_RS10535 (OBK31_10535) | 2217810..2219267 | - | 1458 | WP_003878220.1 | serine/threonine-protein kinase | - |
OBK31_RS10540 (OBK31_10540) | 2219463..2220125 | - | 663 | WP_003872403.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14418.47 Da Isoelectric Point: 4.5642
>T259917 WP_003872398.1 NZ_CP106873:c2215284-2214877 [Mycobacterium avium subsp. paratuberculosis K-10]
MTARPAAGVLDTSVFIASESGRQLDEARIPDEVATTVVTLAELHAGVLAATTSNVRAQRLATLESIADMEMLPVDDDAVR
MWARLRIHLAEAGRRMRANDLWIAAIAASRGLPVVTQDDDFAALDGAANLAIIRV
MTARPAAGVLDTSVFIASESGRQLDEARIPDEVATTVVTLAELHAGVLAATTSNVRAQRLATLESIADMEMLPVDDDAVR
MWARLRIHLAEAGRRMRANDLWIAAIAASRGLPVVTQDDDFAALDGAANLAIIRV
Download Length: 408 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L5MIC8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L5MIC5 |