Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 850742..851395 | Replicon | chromosome |
Accession | NZ_CP106873 | ||
Organism | Mycobacterium avium subsp. paratuberculosis K-10 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | OBK31_RS04360 | Protein ID | WP_003872880.1 |
Coordinates | 850934..851395 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | Q742J1 |
Locus tag | OBK31_RS04355 | Protein ID | WP_003872881.1 |
Coordinates | 850742..850930 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OBK31_RS04345 (OBK31_04345) | 846724..848310 | + | 1587 | WP_003872883.1 | serine hydrolase | - |
OBK31_RS04350 (OBK31_04350) | 848307..850679 | + | 2373 | WP_003872882.1 | HAD-IC family P-type ATPase | - |
OBK31_RS04355 (OBK31_04355) | 850742..850930 | + | 189 | WP_003872881.1 | antitoxin | Antitoxin |
OBK31_RS04360 (OBK31_04360) | 850934..851395 | + | 462 | WP_003872880.1 | SRPBCC family protein | Toxin |
OBK31_RS04365 (OBK31_04365) | 851464..851898 | + | 435 | WP_003877359.1 | hypothetical protein | - |
OBK31_RS04370 (OBK31_04370) | 852894..854477 | + | 1584 | WP_003872878.1 | DUF4185 domain-containing protein | - |
OBK31_RS04375 (OBK31_04375) | 854517..854903 | + | 387 | WP_003872877.1 | hypothetical protein | - |
OBK31_RS04380 (OBK31_04380) | 854938..855156 | - | 219 | WP_016705560.1 | hypothetical protein | - |
OBK31_RS04385 (OBK31_04385) | 855692..856030 | + | 339 | WP_016705559.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16626.19 Da Isoelectric Point: 9.5654
>T259915 WP_003872880.1 NZ_CP106873:850934-851395 [Mycobacterium avium subsp. paratuberculosis K-10]
VAKLSGSIDVPLPPEVAWQHASDLSRYKEWLTIHRVWRSTLPDQIDKGTVVESIVEVKGMLNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKVQPKADGSVVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFARSDPSTNGHR
VAKLSGSIDVPLPPEVAWQHASDLSRYKEWLTIHRVWRSTLPDQIDKGTVVESIVEVKGMLNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKVQPKADGSVVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFARSDPSTNGHR
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|