Detailed information of TA system TA259914

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): BrnTA/BrnT-BrnA
• Location: 243009..243568
• Replicon: chromosome
• Accession: NZ_CP106870
• Organism: Brucella sp. bbatCR03

Toxin (Protein)

• Gene name: brnT
• Uniprot ID: D6LP74
• Locus tag: N7Z69_RS01270
• Protein ID: WP_004688321.1
• Coordinates: 243323..243568 (-)
• Length: 82 a.a.

Antitoxin (Protein)

• Gene name: brnA
• Uniprot ID: Q57DF1
• Locus tag: N7Z69_RS01265
• Protein ID: WP_002964097.1
• Coordinates: 243009..243323 (-)
• Length: 105 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N7Z69_RS01215	238699..238902	-	204	WP_002964087.1	hypothetical protein	-
N7Z69_RS01220	238905..239120	-	216	WP_105985276.1	hypothetical protein	-
N7Z69_RS01225	239117..239320	-	204	WP_002964088.1	hypothetical protein	-
N7Z69_RS01230	239370..240089	+	720	WP_105985277.1	hypothetical protein	-
N7Z69_RS01235	240086..240316	+	231	WP_002964091.1	hypothetical protein	-
N7Z69_RS01240	240313..240588	+	276	WP_002964092.1	hypothetical protein	-
N7Z69_RS01245	240611..241240	+	630	WP_284251425.1	hypothetical protein	-
N7Z69_RS01250	241434..242143	+	710	Protein_239	porin family protein	-
N7Z69_RS01255	242491..242661	-	171	WP_002964095.1	DUF1508 domain-containing protein	-
N7Z69_RS01260	242660..242893	+	234	WP_002969999.1	hypothetical protein	-
N7Z69_RS01265	243009..243323	-	315	WP_002964097.1	BrnA antitoxin family protein	Antitoxin
N7Z69_RS01270	243323..243568	-	246	WP_004688321.1	BrnT family toxin	Toxin
N7Z69_RS01275	243701..244339	+	639	Protein_244	tRNA guanosine transglycosylase	-
N7Z69_RS01280	244409..245167	+	759	Protein_245	IS5 family transposase	-
N7Z69_RS01285	245168..245941	+	774	WP_105984997.1	hypothetical protein	-
N7Z69_RS01290	246271..247721	+	1451	Protein_247	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	wboA / wbdA	237707..251038	13331
	-	flank	IS/Tn	-	-	244409..244777	368

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (5-78)

Antitoxin

• BrnA antitoxin of type II toxin-antitoxin system (28-102)

Sequences

Toxin

Protein

• Length: 82 a.a.
• Molecular weight: 9172.86 Da
• Isoelectric Point: 10.3158

>T259914 WP_004688321.1 NZ_CP106870:c243568-243323 [Brucella sp. bbatCR03]
MKIIWDEPKRQTNIAKHGLDFADLHFEFFLSAKVFPTKADRLMAIGEFNGLIIIAVIFKPVGSEALSVISMRPASQKERK
L

Nucleotide

• Length: 246 bp

Antitoxin

Protein

• Length: 105 a.a.
• Molecular weight: 11638.42 Da
• Isoelectric Point: 10.3131

>AT259914 WP_002964097.1 NZ_CP106870:c243323-243009 [Brucella sp. bbatCR03]
MGIKFSSKRPLTQEEEAEIQKMIASDPDAPEATDEQLAKAKPFKEAFPDMAAKMEKAIRGRPRIDNPKTPVTIRLDQDVV
QRFKATGKGWQGRMNDALRKAVGL

Nucleotide

• Length: 315 bp