Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 68027..68589 | Replicon | chromosome |
Accession | NZ_CP106869 | ||
Organism | Xanthomonas sp. AM6 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OCJ37_RS00315 | Protein ID | WP_263111664.1 |
Coordinates | 68272..68589 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OCJ37_RS00310 | Protein ID | WP_263111662.1 |
Coordinates | 68027..68284 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCJ37_RS00280 (OCJ37_00280) | 63337..63582 | + | 246 | WP_263111657.1 | hypothetical protein | - |
OCJ37_RS00285 (OCJ37_00285) | 64247..64699 | + | 453 | WP_263111658.1 | hypothetical protein | - |
OCJ37_RS00290 (OCJ37_00290) | 64785..65466 | - | 682 | Protein_57 | hypothetical protein | - |
OCJ37_RS00295 (OCJ37_00295) | 65661..66056 | + | 396 | WP_263111659.1 | hypothetical protein | - |
OCJ37_RS00300 (OCJ37_00300) | 66438..67355 | + | 918 | WP_263111660.1 | hypothetical protein | - |
OCJ37_RS00305 (OCJ37_00305) | 67527..67829 | + | 303 | WP_263111661.1 | hypothetical protein | - |
OCJ37_RS00310 (OCJ37_00310) | 68027..68284 | + | 258 | WP_263111662.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OCJ37_RS00315 (OCJ37_00315) | 68272..68589 | + | 318 | WP_263111664.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OCJ37_RS00320 (OCJ37_00320) | 68742..69146 | + | 405 | WP_263111665.1 | Na+:solute symporter | - |
OCJ37_RS00325 (OCJ37_00325) | 69391..69801 | + | 411 | WP_263111666.1 | hypothetical protein | - |
OCJ37_RS00330 (OCJ37_00330) | 70016..70780 | - | 765 | WP_263111667.1 | OBAP family protein | - |
OCJ37_RS00335 (OCJ37_00335) | 71220..73484 | + | 2265 | WP_263113762.1 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 58586..69801 | 11215 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11838.65 Da Isoelectric Point: 8.9974
>T259910 WP_263111664.1 NZ_CP106869:68272-68589 [Xanthomonas sp. AM6]
MAEIVWSEPALGDLDAIADYIALESPLAASEFVKRVFAHVGQLADHPESGSRPPELGRSRYRQIVEPPCRVFYRFDGHQV
FILHVMRSERILRKARLAPAAKQGK
MAEIVWSEPALGDLDAIADYIALESPLAASEFVKRVFAHVGQLADHPESGSRPPELGRSRYRQIVEPPCRVFYRFDGHQV
FILHVMRSERILRKARLAPAAKQGK
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|