Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3186830..3187493 | Replicon | chromosome |
| Accession | NZ_CP106852 | ||
| Organism | Edwardsiella ictaluri strain E9-302 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | C5BAS3 |
| Locus tag | N8I67_RS15040 | Protein ID | WP_015872556.1 |
| Coordinates | 3186830..3187246 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | C5BAS4 |
| Locus tag | N8I67_RS15045 | Protein ID | WP_015872557.1 |
| Coordinates | 3187227..3187493 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I67_RS15020 (N8I67_15020) | 3182754..3184487 | - | 1734 | WP_015872552.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N8I67_RS15025 (N8I67_15025) | 3184492..3185208 | - | 717 | WP_015872553.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N8I67_RS15030 (N8I67_15030) | 3185236..3186135 | - | 900 | WP_015872554.1 | site-specific tyrosine recombinase XerD | - |
| N8I67_RS15035 (N8I67_15035) | 3186293..3186805 | + | 513 | WP_015872555.1 | flavodoxin FldB | - |
| N8I67_RS15040 (N8I67_15040) | 3186830..3187246 | - | 417 | WP_015872556.1 | protein YgfX | Toxin |
| N8I67_RS15045 (N8I67_15045) | 3187227..3187493 | - | 267 | WP_015872557.1 | FAD assembly factor SdhE | Antitoxin |
| N8I67_RS15050 (N8I67_15050) | 3187841..3188836 | + | 996 | WP_015872558.1 | tRNA-modifying protein YgfZ | - |
| N8I67_RS15055 (N8I67_15055) | 3188877..3189701 | - | 825 | WP_015872559.1 | shikimate 5-dehydrogenase | - |
| N8I67_RS15060 (N8I67_15060) | 3189863..3190735 | - | 873 | WP_015872560.1 | nucleoside-specific channel-forming protein Tsx | - |
| N8I67_RS15065 (N8I67_15065) | 3191344..3191994 | + | 651 | WP_035609190.1 | hemolysin III family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16145.89 Da Isoelectric Point: 11.3233
>T259907 WP_015872556.1 NZ_CP106852:c3187246-3186830 [Edwardsiella ictaluri]
VALWRCNVHASWRTQVMFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRLIARNSGELQRLAPQVWHWQLR
EWRLARRPWVSDLGALLILQSTHGTPCRRRLWLAADSMSREEWGQLRRALLDTGDDRV
VALWRCNVHASWRTQVMFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRLIARNSGELQRLAPQVWHWQLR
EWRLARRPWVSDLGALLILQSTHGTPCRRRLWLAADSMSREEWGQLRRALLDTGDDRV
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|