Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 1951359..1951881 | Replicon | chromosome |
Accession | NZ_CP106852 | ||
Organism | Edwardsiella ictaluri strain E9-302 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C5BBL4 |
Locus tag | N8I67_RS09200 | Protein ID | WP_015871319.1 |
Coordinates | 1951600..1951881 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | C5BBL3 |
Locus tag | N8I67_RS09195 | Protein ID | WP_015871318.1 |
Coordinates | 1951359..1951610 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I67_RS09165 (N8I67_09165) | 1946515..1947177 | - | 663 | WP_015871312.1 | hypothetical protein | - |
N8I67_RS09170 (N8I67_09170) | 1947177..1947737 | - | 561 | WP_263115783.1 | hypothetical protein | - |
N8I67_RS09175 (N8I67_09175) | 1947758..1948201 | - | 444 | WP_015871314.1 | hypothetical protein | - |
N8I67_RS09180 (N8I67_09180) | 1948243..1948638 | - | 396 | WP_049640651.1 | hypothetical protein | - |
N8I67_RS09185 (N8I67_09185) | 1948796..1950052 | - | 1257 | WP_198077050.1 | N4-gp56 family major capsid protein | - |
N8I67_RS09190 (N8I67_09190) | 1950070..1951071 | - | 1002 | WP_015871317.1 | hypothetical protein | - |
N8I67_RS09195 (N8I67_09195) | 1951359..1951610 | + | 252 | WP_015871318.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N8I67_RS09200 (N8I67_09200) | 1951600..1951881 | + | 282 | WP_015871319.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8I67_RS09205 (N8I67_09205) | 1951953..1954067 | - | 2115 | WP_015871320.1 | hypothetical protein | - |
N8I67_RS09210 (N8I67_09210) | 1954064..1955725 | - | 1662 | WP_050977403.1 | terminase | - |
N8I67_RS09215 (N8I67_09215) | 1955718..1956140 | - | 423 | WP_232347283.1 | hypothetical protein | - |
N8I67_RS09220 (N8I67_09220) | 1956275..1956502 | - | 228 | WP_232347284.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1927647..1985438 | 57791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10783.62 Da Isoelectric Point: 10.6993
>T259903 WP_015871319.1 NZ_CP106852:1951600-1951881 [Edwardsiella ictaluri]
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHVPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNEVYQAADSR
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHVPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNEVYQAADSR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|