Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1109815..1110407 | Replicon | chromosome |
Accession | NZ_CP106852 | ||
Organism | Edwardsiella ictaluri strain E9-302 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D0ZEC2 |
Locus tag | N8I67_RS05165 | Protein ID | WP_012847872.1 |
Coordinates | 1109815..1110018 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | C5BCY7 |
Locus tag | N8I67_RS05170 | Protein ID | WP_015870487.1 |
Coordinates | 1110039..1110407 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I67_RS05125 (N8I67_05125) | 1105035..1105496 | + | 462 | WP_015870480.1 | Lrp/AsnC family transcriptional regulator | - |
N8I67_RS05130 (N8I67_05130) | 1105525..1105692 | - | 168 | WP_015870481.1 | hypothetical protein | - |
N8I67_RS05135 (N8I67_05135) | 1105795..1106133 | + | 339 | WP_015870482.1 | P-II family nitrogen regulator | - |
N8I67_RS05140 (N8I67_05140) | 1106155..1107435 | + | 1281 | WP_198077273.1 | ammonium transporter AmtB | - |
N8I67_RS05145 (N8I67_05145) | 1107469..1108335 | - | 867 | WP_015870484.1 | acyl-CoA thioesterase II | - |
N8I67_RS05150 (N8I67_05150) | 1108381..1108710 | - | 330 | WP_015870485.1 | MGMT family protein | - |
N8I67_RS05160 (N8I67_05160) | 1109688..1109795 | + | 108 | Protein_990 | IS5/IS1182 family transposase | - |
N8I67_RS05165 (N8I67_05165) | 1109815..1110018 | - | 204 | WP_012847872.1 | HHA domain-containing protein | Toxin |
N8I67_RS05170 (N8I67_05170) | 1110039..1110407 | - | 369 | WP_015870487.1 | Hha toxicity modulator TomB | Antitoxin |
N8I67_RS05175 (N8I67_05175) | 1110767..1113919 | - | 3153 | WP_015870488.1 | efflux RND transporter permease subunit | - |
N8I67_RS05180 (N8I67_05180) | 1113963..1115147 | - | 1185 | WP_015870489.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8103.37 Da Isoelectric Point: 5.0914
>T259902 WP_012847872.1 NZ_CP106852:c1110018-1109815 [Edwardsiella ictaluri]
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14287.03 Da Isoelectric Point: 5.4786
>AT259902 WP_015870487.1 NZ_CP106852:c1110407-1110039 [Edwardsiella ictaluri]
MDENTSYQHDISELKYLCDYLYHQGIDVLGESNHGWVSDPTAEVNLQLNELIEHIASIAQSFKIKYPRHSDLAEMLDYYL
DETYALFGTYSISETALRQWLRTKRRMAYCLAHEKRNAALHV
MDENTSYQHDISELKYLCDYLYHQGIDVLGESNHGWVSDPTAEVNLQLNELIEHIASIAQSFKIKYPRHSDLAEMLDYYL
DETYALFGTYSISETALRQWLRTKRRMAYCLAHEKRNAALHV
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A034SMG4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | C5BCY7 |