Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 889392..890055 | Replicon | chromosome |
Accession | NZ_CP106852 | ||
Organism | Edwardsiella ictaluri strain E9-302 |
Toxin (Protein)
Gene name | tad | Uniprot ID | C5B7U4 |
Locus tag | N8I67_RS04160 | Protein ID | WP_015870280.1 |
Coordinates | 889711..890055 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | N8I67_RS04155 | Protein ID | WP_015870279.1 |
Coordinates | 889392..889709 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I67_RS04110 (N8I67_04110) | 884723..885271 | + | 549 | WP_015870271.1 | YaeQ family protein | - |
N8I67_RS04115 (N8I67_04115) | 885273..885689 | + | 417 | WP_015870272.1 | alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB | - |
N8I67_RS04120 (N8I67_04120) | 885786..886463 | + | 678 | WP_015870273.1 | envelope stress response activation lipoprotein NlpE | - |
N8I67_RS04125 (N8I67_04125) | 886485..886745 | - | 261 | WP_015870274.1 | YfhL family 4Fe-4S dicluster ferredoxin | - |
N8I67_RS04130 (N8I67_04130) | 887350..887628 | + | 279 | WP_133175613.1 | hypothetical protein | - |
N8I67_RS04140 (N8I67_04140) | 888573..888752 | + | 180 | WP_071525714.1 | hypothetical protein | - |
N8I67_RS04145 (N8I67_04145) | 888857..888985 | + | 129 | WP_015870277.1 | hypothetical protein | - |
N8I67_RS04150 (N8I67_04150) | 888982..889359 | + | 378 | WP_015870278.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
N8I67_RS04155 (N8I67_04155) | 889392..889709 | - | 318 | WP_015870279.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N8I67_RS04160 (N8I67_04160) | 889711..890055 | - | 345 | WP_015870280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8I67_RS04165 (N8I67_04165) | 890227..890445 | - | 219 | WP_232347353.1 | head completion/stabilization protein | - |
N8I67_RS04170 (N8I67_04170) | 890474..891163 | + | 690 | WP_015870281.1 | phage portal protein | - |
N8I67_RS04175 (N8I67_04175) | 892291..893138 | - | 848 | Protein_795 | MurR/RpiR family transcriptional regulator | - |
N8I67_RS04180 (N8I67_04180) | 893294..893938 | + | 645 | WP_226092411.1 | phosphatidylglycerophosphatase C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 888982..902049 | 13067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12544.34 Da Isoelectric Point: 9.8474
>T259901 WP_015870280.1 NZ_CP106852:c890055-889711 [Edwardsiella ictaluri]
MKSLYWVGSTKKDLQSLPEEVQDIFGYALHLAQVGGKHSQTKPLKGFSGAGVLEVVEDFLGDTYRAVYTVKFGDAVYVSH
VFQKKSSSGIATPKLNMDKIRERLKAAENHARGA
MKSLYWVGSTKKDLQSLPEEVQDIFGYALHLAQVGGKHSQTKPLKGFSGAGVLEVVEDFLGDTYRAVYTVKFGDAVYVSH
VFQKKSSSGIATPKLNMDKIRERLKAAENHARGA
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|