Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 1951742..1952264 | Replicon | chromosome |
| Accession | NZ_CP106849 | ||
| Organism | Edwardsiella ictaluri strain 669 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C5BBL4 |
| Locus tag | N8I66_RS09205 | Protein ID | WP_015871319.1 |
| Coordinates | 1951983..1952264 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C5BBL3 |
| Locus tag | N8I66_RS09200 | Protein ID | WP_015871318.1 |
| Coordinates | 1951742..1951993 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I66_RS09170 (N8I66_09170) | 1946898..1947560 | - | 663 | WP_015871312.1 | hypothetical protein | - |
| N8I66_RS09175 (N8I66_09175) | 1947560..1948120 | - | 561 | WP_263115783.1 | hypothetical protein | - |
| N8I66_RS09180 (N8I66_09180) | 1948141..1948584 | - | 444 | WP_015871314.1 | hypothetical protein | - |
| N8I66_RS09185 (N8I66_09185) | 1948626..1949021 | - | 396 | WP_049640651.1 | hypothetical protein | - |
| N8I66_RS09190 (N8I66_09190) | 1949179..1950435 | - | 1257 | WP_198077050.1 | N4-gp56 family major capsid protein | - |
| N8I66_RS09195 (N8I66_09195) | 1950453..1951454 | - | 1002 | WP_015871317.1 | hypothetical protein | - |
| N8I66_RS09200 (N8I66_09200) | 1951742..1951993 | + | 252 | WP_015871318.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N8I66_RS09205 (N8I66_09205) | 1951983..1952264 | + | 282 | WP_015871319.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8I66_RS09210 (N8I66_09210) | 1952336..1954450 | - | 2115 | WP_015871320.1 | hypothetical protein | - |
| N8I66_RS09215 (N8I66_09215) | 1954447..1956108 | - | 1662 | WP_050977403.1 | terminase | - |
| N8I66_RS09220 (N8I66_09220) | 1956101..1956523 | - | 423 | WP_232347283.1 | hypothetical protein | - |
| N8I66_RS09225 (N8I66_09225) | 1956658..1956885 | - | 228 | WP_232347284.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1928030..1985821 | 57791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10783.62 Da Isoelectric Point: 10.6993
>T259895 WP_015871319.1 NZ_CP106849:1951983-1952264 [Edwardsiella ictaluri]
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHVPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNEVYQAADSR
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHVPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNEVYQAADSR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|