Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1109813..1110405 | Replicon | chromosome |
| Accession | NZ_CP106849 | ||
| Organism | Edwardsiella ictaluri strain 669 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D0ZEC2 |
| Locus tag | N8I66_RS05170 | Protein ID | WP_012847872.1 |
| Coordinates | 1109813..1110016 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | C5BCY7 |
| Locus tag | N8I66_RS05175 | Protein ID | WP_015870487.1 |
| Coordinates | 1110037..1110405 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I66_RS05130 (N8I66_05130) | 1105033..1105494 | + | 462 | WP_015870480.1 | Lrp/AsnC family transcriptional regulator | - |
| N8I66_RS05135 (N8I66_05135) | 1105523..1105690 | - | 168 | WP_015870481.1 | hypothetical protein | - |
| N8I66_RS05140 (N8I66_05140) | 1105793..1106131 | + | 339 | WP_015870482.1 | P-II family nitrogen regulator | - |
| N8I66_RS05145 (N8I66_05145) | 1106153..1107433 | + | 1281 | WP_198077273.1 | ammonium transporter AmtB | - |
| N8I66_RS05150 (N8I66_05150) | 1107467..1108333 | - | 867 | WP_015870484.1 | acyl-CoA thioesterase II | - |
| N8I66_RS05155 (N8I66_05155) | 1108379..1108708 | - | 330 | WP_015870485.1 | MGMT family protein | - |
| N8I66_RS05165 (N8I66_05165) | 1109686..1109793 | + | 108 | Protein_991 | IS5/IS1182 family transposase | - |
| N8I66_RS05170 (N8I66_05170) | 1109813..1110016 | - | 204 | WP_012847872.1 | HHA domain-containing protein | Toxin |
| N8I66_RS05175 (N8I66_05175) | 1110037..1110405 | - | 369 | WP_015870487.1 | Hha toxicity modulator TomB | Antitoxin |
| N8I66_RS05180 (N8I66_05180) | 1110765..1113917 | - | 3153 | WP_015870488.1 | efflux RND transporter permease subunit | - |
| N8I66_RS05185 (N8I66_05185) | 1113961..1115145 | - | 1185 | WP_015870489.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8103.37 Da Isoelectric Point: 5.0914
>T259894 WP_012847872.1 NZ_CP106849:c1110016-1109813 [Edwardsiella ictaluri]
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14287.03 Da Isoelectric Point: 5.4786
>AT259894 WP_015870487.1 NZ_CP106849:c1110405-1110037 [Edwardsiella ictaluri]
MDENTSYQHDISELKYLCDYLYHQGIDVLGESNHGWVSDPTAEVNLQLNELIEHIASIAQSFKIKYPRHSDLAEMLDYYL
DETYALFGTYSISETALRQWLRTKRRMAYCLAHEKRNAALHV
MDENTSYQHDISELKYLCDYLYHQGIDVLGESNHGWVSDPTAEVNLQLNELIEHIASIAQSFKIKYPRHSDLAEMLDYYL
DETYALFGTYSISETALRQWLRTKRRMAYCLAHEKRNAALHV
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A034SMG4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | C5BCY7 |