Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 889390..890053 | Replicon | chromosome |
| Accession | NZ_CP106849 | ||
| Organism | Edwardsiella ictaluri strain 669 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | C5B7U4 |
| Locus tag | N8I66_RS04160 | Protein ID | WP_015870280.1 |
| Coordinates | 889709..890053 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | N8I66_RS04155 | Protein ID | WP_015870279.1 |
| Coordinates | 889390..889707 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I66_RS04110 (N8I66_04110) | 884721..885269 | + | 549 | WP_015870271.1 | YaeQ family protein | - |
| N8I66_RS04115 (N8I66_04115) | 885271..885687 | + | 417 | WP_015870272.1 | alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB | - |
| N8I66_RS04120 (N8I66_04120) | 885784..886461 | + | 678 | WP_015870273.1 | envelope stress response activation lipoprotein NlpE | - |
| N8I66_RS04125 (N8I66_04125) | 886483..886743 | - | 261 | WP_015870274.1 | YfhL family 4Fe-4S dicluster ferredoxin | - |
| N8I66_RS04130 (N8I66_04130) | 887348..887626 | + | 279 | WP_133175613.1 | hypothetical protein | - |
| N8I66_RS04140 (N8I66_04140) | 888571..888750 | + | 180 | WP_071525714.1 | hypothetical protein | - |
| N8I66_RS04145 (N8I66_04145) | 888855..888983 | + | 129 | WP_015870277.1 | hypothetical protein | - |
| N8I66_RS04150 (N8I66_04150) | 888980..889357 | + | 378 | WP_015870278.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| N8I66_RS04155 (N8I66_04155) | 889390..889707 | - | 318 | WP_015870279.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N8I66_RS04160 (N8I66_04160) | 889709..890053 | - | 345 | WP_015870280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8I66_RS04165 (N8I66_04165) | 890225..890443 | - | 219 | WP_232347353.1 | head completion/stabilization protein | - |
| N8I66_RS04170 (N8I66_04170) | 890472..891161 | + | 690 | WP_015870281.1 | phage portal protein | - |
| N8I66_RS04175 (N8I66_04175) | 892289..893136 | - | 848 | Protein_795 | MurR/RpiR family transcriptional regulator | - |
| N8I66_RS04180 (N8I66_04180) | 893292..893936 | + | 645 | WP_226092411.1 | phosphatidylglycerophosphatase C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 888980..902047 | 13067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12544.34 Da Isoelectric Point: 9.8474
>T259893 WP_015870280.1 NZ_CP106849:c890053-889709 [Edwardsiella ictaluri]
MKSLYWVGSTKKDLQSLPEEVQDIFGYALHLAQVGGKHSQTKPLKGFSGAGVLEVVEDFLGDTYRAVYTVKFGDAVYVSH
VFQKKSSSGIATPKLNMDKIRERLKAAENHARGA
MKSLYWVGSTKKDLQSLPEEVQDIFGYALHLAQVGGKHSQTKPLKGFSGAGVLEVVEDFLGDTYRAVYTVKFGDAVYVSH
VFQKKSSSGIATPKLNMDKIRERLKAAENHARGA
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|