Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 4275..4822 Replicon plasmid unnamed
Accession NZ_CP106842
Organism Paenalcaligenes faecalis strain YLCF04

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag N7U67_RS12850 Protein ID WP_269902253.1
Coordinates 4487..4822 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag N7U67_RS12845 Protein ID WP_269902252.1
Coordinates 4275..4496 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7U67_RS12815 512..817 - 306 WP_009873361.1 tyrosine-type recombinase/integrase -
N7U67_RS12820 1025..1363 - 339 WP_002310911.1 hypothetical protein -
N7U67_RS12825 1267..2457 - 1191 WP_000841446.1 tetracycline efflux MFS transporter Tet(C) -
N7U67_RS12830 2550..3185 + 636 WP_009873364.1 tetracycline resistance transcriptional repressor TetR(C) -
N7U67_RS12835 3208..3663 - 456 WP_009873365.1 IS200/IS605 family transposase -
N7U67_RS12840 3783..4097 - 315 WP_269902251.1 helix-turn-helix transcriptional regulator -
N7U67_RS12845 4275..4496 + 222 WP_269902252.1 antitoxin MazE family protein Antitoxin
N7U67_RS12850 4487..4822 + 336 WP_269902253.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
N7U67_RS12855 5127..5693 + 567 WP_269902254.1 DNA-binding protein -
N7U67_RS12860 5872..6159 + 288 WP_269902255.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
N7U67_RS12865 6155..6421 + 267 WP_269902257.1 type II toxin-antitoxin system YafQ family toxin -
N7U67_RS12870 6756..7592 - 837 WP_269902256.1 replication initiation protein RepM -
N7U67_RS12875 7935..8210 - 276 WP_269902245.1 hypothetical protein -
N7U67_RS12880 8210..9139 - 930 WP_269902246.1 integrase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(C) - 1..14591 14591


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-106)

Antitoxin

Antitoxin MazE-like

(10-72)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12087.25 Da        Isoelectric Point: 9.2525

>T259892 WP_269902253.1 NZ_CP106842:4487-4822 [Paenalcaligenes faecalis]
VGIVRRGDIVSIATQGDFGKPRPALVIQSDLFSAHPSVSVLPITSFLIDAPLLRITLEPNEFNGLKKKSQVMIDKIITVV
REKVGGQIGSLDFATMQEIDRCLAVFLGIVR

Download         Length: 336 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8290.46 Da        Isoelectric Point: 7.1665

>AT259892 WP_269902252.1 NZ_CP106842:4275-4496 [Paenalcaligenes faecalis]
MRPDTPNSTSRVQKHRAKLRKAGMKPVQIWVPDTTSKAFIAECERQSRLIAQSDDVMTHGLLDEALIEVDGWE

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References