Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 4275..4822 | Replicon | plasmid unnamed |
| Accession | NZ_CP106842 | ||
| Organism | Paenalcaligenes faecalis strain YLCF04 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | N7U67_RS12850 | Protein ID | WP_269902253.1 |
| Coordinates | 4487..4822 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | N7U67_RS12845 | Protein ID | WP_269902252.1 |
| Coordinates | 4275..4496 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7U67_RS12815 | 512..817 | - | 306 | WP_009873361.1 | tyrosine-type recombinase/integrase | - |
| N7U67_RS12820 | 1025..1363 | - | 339 | WP_002310911.1 | hypothetical protein | - |
| N7U67_RS12825 | 1267..2457 | - | 1191 | WP_000841446.1 | tetracycline efflux MFS transporter Tet(C) | - |
| N7U67_RS12830 | 2550..3185 | + | 636 | WP_009873364.1 | tetracycline resistance transcriptional repressor TetR(C) | - |
| N7U67_RS12835 | 3208..3663 | - | 456 | WP_009873365.1 | IS200/IS605 family transposase | - |
| N7U67_RS12840 | 3783..4097 | - | 315 | WP_269902251.1 | helix-turn-helix transcriptional regulator | - |
| N7U67_RS12845 | 4275..4496 | + | 222 | WP_269902252.1 | antitoxin MazE family protein | Antitoxin |
| N7U67_RS12850 | 4487..4822 | + | 336 | WP_269902253.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| N7U67_RS12855 | 5127..5693 | + | 567 | WP_269902254.1 | DNA-binding protein | - |
| N7U67_RS12860 | 5872..6159 | + | 288 | WP_269902255.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| N7U67_RS12865 | 6155..6421 | + | 267 | WP_269902257.1 | type II toxin-antitoxin system YafQ family toxin | - |
| N7U67_RS12870 | 6756..7592 | - | 837 | WP_269902256.1 | replication initiation protein RepM | - |
| N7U67_RS12875 | 7935..8210 | - | 276 | WP_269902245.1 | hypothetical protein | - |
| N7U67_RS12880 | 8210..9139 | - | 930 | WP_269902246.1 | integrase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(C) | - | 1..14591 | 14591 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12087.25 Da Isoelectric Point: 9.2525
>T259892 WP_269902253.1 NZ_CP106842:4487-4822 [Paenalcaligenes faecalis]
VGIVRRGDIVSIATQGDFGKPRPALVIQSDLFSAHPSVSVLPITSFLIDAPLLRITLEPNEFNGLKKKSQVMIDKIITVV
REKVGGQIGSLDFATMQEIDRCLAVFLGIVR
VGIVRRGDIVSIATQGDFGKPRPALVIQSDLFSAHPSVSVLPITSFLIDAPLLRITLEPNEFNGLKKKSQVMIDKIITVV
REKVGGQIGSLDFATMQEIDRCLAVFLGIVR
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|