Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 2332213..2333826 | Replicon | chromosome |
Accession | NZ_CP106841 | ||
Organism | Paenalcaligenes faecalis strain YLCF04 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | N7U67_RS11050 | Protein ID | WP_269900686.1 |
Coordinates | 2332213..2333562 (-) | Length | 450 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | N7U67_RS11055 | Protein ID | WP_269900687.1 |
Coordinates | 2333566..2333826 (-) | Length | 87 a.a. |
Genomic Context
Location: 2334965..2336086 (1122 bp)
Type: Others
Protein ID: WP_269900689.1
Type: Others
Protein ID: WP_269900689.1
Location: 2327712..2328113 (402 bp)
Type: Others
Protein ID: WP_269900682.1
Type: Others
Protein ID: WP_269900682.1
Location: 2328116..2328823 (708 bp)
Type: Others
Protein ID: WP_269900683.1
Type: Others
Protein ID: WP_269900683.1
Location: 2328813..2329643 (831 bp)
Type: Others
Protein ID: WP_269900684.1
Type: Others
Protein ID: WP_269900684.1
Location: 2330072..2330320 (249 bp)
Type: Others
Protein ID: Protein_2153
Type: Others
Protein ID: Protein_2153
Location: 2330350..2331726 (1377 bp)
Type: Others
Protein ID: WP_269900685.1
Type: Others
Protein ID: WP_269900685.1
Location: 2332213..2333562 (1350 bp)
Type: Toxin
Protein ID: WP_269900686.1
Type: Toxin
Protein ID: WP_269900686.1
Location: 2333566..2333826 (261 bp)
Type: Antitoxin
Protein ID: WP_269900687.1
Type: Antitoxin
Protein ID: WP_269900687.1
Location: 2334339..2334776 (438 bp)
Type: Others
Protein ID: WP_269900688.1
Type: Others
Protein ID: WP_269900688.1
Location: 2336102..2337070 (969 bp)
Type: Others
Protein ID: WP_269900690.1
Type: Others
Protein ID: WP_269900690.1
Location: 2337166..2337654 (489 bp)
Type: Others
Protein ID: WP_269900691.1
Type: Others
Protein ID: WP_269900691.1
Location: 2337654..2338202 (549 bp)
Type: Others
Protein ID: WP_269900692.1
Type: Others
Protein ID: WP_269900692.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7U67_RS11025 | 2327712..2328113 | - | 402 | WP_269900682.1 | hypothetical protein | - |
N7U67_RS11030 | 2328116..2328823 | - | 708 | WP_269900683.1 | hypothetical protein | - |
N7U67_RS11035 | 2328813..2329643 | - | 831 | WP_269900684.1 | hypothetical protein | - |
N7U67_RS11040 | 2330072..2330320 | - | 249 | Protein_2153 | transposase | - |
N7U67_RS11045 | 2330350..2331726 | - | 1377 | WP_269900685.1 | integrase family protein | - |
N7U67_RS11050 | 2332213..2333562 | - | 1350 | WP_269900686.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
N7U67_RS11055 | 2333566..2333826 | - | 261 | WP_269900687.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7U67_RS11060 | 2334339..2334776 | - | 438 | WP_269900688.1 | hypothetical protein | - |
N7U67_RS11065 | 2334965..2336086 | + | 1122 | WP_269900689.1 | diguanylate cyclase | - |
N7U67_RS11070 | 2336102..2337070 | - | 969 | WP_269900690.1 | chemotaxis protein | - |
N7U67_RS11075 | 2337166..2337654 | - | 489 | WP_269900691.1 | hypothetical protein | - |
N7U67_RS11080 | 2337654..2338202 | - | 549 | WP_269900692.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 450 a.a. Molecular weight: 50043.20 Da Isoelectric Point: 6.5764
>T259891 WP_269900686.1 NZ_CP106841:c2333562-2332213 [Paenalcaligenes faecalis]
MGRRSHTQTLYLWMNGYFVGTWSVRPYTGDILQYDEGWVVSEHGRPLSLSLPFTPGNPPHRGDAVRTYFENLLPDSEDIL
KRVARRFQASSTGAFALLAEIGRDCVGALQILPDNVPPEGVQEVSATPLTDAEVAQVLRNTLASVSLIQGSDDVDFRISI
AGAQEKTALSWLNGQWCLPHGATPTTHIFKLPLGLVGNLRFDMSDSVENEWLCSKILHAYGLPVASTQILEFEDMKVLAV
ERFDRMWWENEEGKRWLLRIPQEDMCQATGTPPYLKYESDGGPGVRTIMKLLATSRDPDRDRRTFFQAQVLFWMLSATDG
HAKNFSIFLRPEGTYELTPLYDVLSAYPVIGKGANQLSPFKAKLAMAVRSKNPHWVMRDILRRHWLAVGAEHGVVAPDGR
GAEAVLDDLVAKTPEVVRAVRALLPKRFPEHVADSILNGLQLAANKLTG
MGRRSHTQTLYLWMNGYFVGTWSVRPYTGDILQYDEGWVVSEHGRPLSLSLPFTPGNPPHRGDAVRTYFENLLPDSEDIL
KRVARRFQASSTGAFALLAEIGRDCVGALQILPDNVPPEGVQEVSATPLTDAEVAQVLRNTLASVSLIQGSDDVDFRISI
AGAQEKTALSWLNGQWCLPHGATPTTHIFKLPLGLVGNLRFDMSDSVENEWLCSKILHAYGLPVASTQILEFEDMKVLAV
ERFDRMWWENEEGKRWLLRIPQEDMCQATGTPPYLKYESDGGPGVRTIMKLLATSRDPDRDRRTFFQAQVLFWMLSATDG
HAKNFSIFLRPEGTYELTPLYDVLSAYPVIGKGANQLSPFKAKLAMAVRSKNPHWVMRDILRRHWLAVGAEHGVVAPDGR
GAEAVLDDLVAKTPEVVRAVRALLPKRFPEHVADSILNGLQLAANKLTG
Download Length: 1350 bp