Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 163755..164506 | Replicon | plasmid unnamed |
| Accession | NZ_CP106839 | ||
| Organism | Klebsiella michiganensis strain K5-3 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | N6B35_RS29130 | Protein ID | WP_263075199.1 |
| Coordinates | 164024..164506 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | W9B1S8 |
| Locus tag | N6B35_RS29125 | Protein ID | WP_016529519.1 |
| Coordinates | 163755..164033 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6B35_RS29110 (N6B35_29110) | 160864..161355 | + | 492 | WP_263075196.1 | hypothetical protein | - |
| N6B35_RS29115 (N6B35_29115) | 161589..161903 | - | 315 | WP_263075197.1 | hypothetical protein | - |
| N6B35_RS29120 (N6B35_29120) | 162911..163447 | - | 537 | WP_263075198.1 | hypothetical protein | - |
| N6B35_RS29125 (N6B35_29125) | 163755..164033 | + | 279 | WP_016529519.1 | DUF1778 domain-containing protein | Antitoxin |
| N6B35_RS29130 (N6B35_29130) | 164024..164506 | + | 483 | WP_263075199.1 | GNAT family N-acetyltransferase | Toxin |
| N6B35_RS29135 (N6B35_29135) | 164544..164948 | + | 405 | WP_263075200.1 | DUF2251 domain-containing protein | - |
| N6B35_RS29140 (N6B35_29140) | 165285..166118 | + | 834 | WP_263075201.1 | GIY-YIG nuclease family protein | - |
| N6B35_RS29145 (N6B35_29145) | 166232..166381 | + | 150 | WP_263075202.1 | bacteriocin immunity protein | - |
| N6B35_RS29150 (N6B35_29150) | 166475..166711 | - | 237 | WP_032416774.1 | hypothetical protein | - |
| N6B35_RS29155 (N6B35_29155) | 167752..168480 | + | 729 | WP_080929193.1 | hypothetical protein | - |
| N6B35_RS29160 (N6B35_29160) | 168564..168737 | + | 174 | Protein_176 | EcsC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..301524 | 301524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17785.72 Da Isoelectric Point: 9.4946
>T259890 WP_263075199.1 NZ_CP106839:164024-164506 [Klebsiella michiganensis]
MGMRTPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRTPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|