Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
| Location | 124739..125261 | Replicon | plasmid unnamed |
| Accession | NZ_CP106839 | ||
| Organism | Klebsiella michiganensis strain K5-3 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | - |
| Locus tag | N6B35_RS28920 | Protein ID | WP_263075371.1 |
| Coordinates | 124739..125023 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | - |
| Locus tag | N6B35_RS28925 | Protein ID | WP_263075372.1 |
| Coordinates | 125013..125261 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6B35_RS28890 (N6B35_28890) | 120713..121837 | + | 1125 | WP_263075368.1 | N-acetyltransferase | - |
| N6B35_RS28895 (N6B35_28895) | 122057..122422 | + | 366 | WP_263075369.1 | diacylglycerol kinase | - |
| N6B35_RS28900 (N6B35_28900) | 122514..123416 | + | 903 | WP_263075370.1 | LysR family transcriptional regulator | - |
| N6B35_RS28905 (N6B35_28905) | 123409..124196 | - | 788 | Protein_125 | substrate-binding domain-containing protein | - |
| N6B35_RS28910 (N6B35_28910) | 124224..124549 | - | 326 | Protein_126 | citrate-proton symporter | - |
| N6B35_RS28915 (N6B35_28915) | 124539..124643 | + | 105 | Protein_127 | transposase | - |
| N6B35_RS28920 (N6B35_28920) | 124739..125023 | - | 285 | WP_263075371.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N6B35_RS28925 (N6B35_28925) | 125013..125261 | - | 249 | WP_263075372.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N6B35_RS28930 (N6B35_28930) | 125542..126663 | - | 1122 | Protein_130 | transposase | - |
| N6B35_RS28935 (N6B35_28935) | 126782..127360 | - | 579 | WP_263075373.1 | DUF4755 domain-containing protein | - |
| N6B35_RS28940 (N6B35_28940) | 127949..129133 | - | 1185 | WP_263075374.1 | cupin | - |
| N6B35_RS28945 (N6B35_28945) | 129144..129926 | - | 783 | WP_263075375.1 | aldolase/citrate lyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..301524 | 301524 | |
| - | inside | IScluster/Tn | - | - | 124488..126588 | 2100 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10847.53 Da Isoelectric Point: 10.2847
>T259889 WP_263075371.1 NZ_CP106839:c125023-124739 [Klebsiella michiganensis]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNSRVPASQLHGRQDQYKIKLCGAGCRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNSRVPASQLHGRQDQYKIKLCGAGCRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|