Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 85783..86360 | Replicon | plasmid unnamed |
Accession | NZ_CP106839 | ||
Organism | Klebsiella michiganensis strain K5-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N6B35_RS28720 | Protein ID | WP_263075339.1 |
Coordinates | 85783..86115 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | N6B35_RS28725 | Protein ID | WP_263075340.1 |
Coordinates | 86115..86360 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6B35_RS28705 (N6B35_28705) | 83042..84031 | + | 990 | WP_072002161.1 | S8 family serine peptidase | - |
N6B35_RS28710 (N6B35_28710) | 84358..85437 | - | 1080 | WP_004220208.1 | IS481-like element ISKpn28 family transposase | - |
N6B35_RS28715 (N6B35_28715) | 85535..85642 | + | 108 | WP_263075338.1 | hypothetical protein | - |
N6B35_RS28720 (N6B35_28720) | 85783..86115 | - | 333 | WP_263075339.1 | endoribonuclease MazF | Toxin |
N6B35_RS28725 (N6B35_28725) | 86115..86360 | - | 246 | WP_263075340.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N6B35_RS28730 (N6B35_28730) | 87456..87671 | + | 216 | WP_263075341.1 | hypothetical protein | - |
N6B35_RS28735 (N6B35_28735) | 87761..88048 | + | 288 | WP_263075342.1 | hypothetical protein | - |
N6B35_RS28740 (N6B35_28740) | 88225..88479 | + | 255 | WP_263075343.1 | hypothetical protein | - |
N6B35_RS28745 (N6B35_28745) | 89335..89613 | + | 279 | WP_263075344.1 | hypothetical protein | - |
N6B35_RS28750 (N6B35_28750) | 89669..90442 | - | 774 | WP_263075345.1 | nuclease-related domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..301524 | 301524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.82 Da Isoelectric Point: 8.7208
>T259888 WP_263075339.1 NZ_CP106839:c86115-85783 [Klebsiella michiganensis]
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQIKGYPFEVTLSGSKEGVALSDQVTCV
DWRARKVTKKATVNSTELAEIRAKAKALIG
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQIKGYPFEVTLSGSKEGVALSDQVTCV
DWRARKVTKKATVNSTELAEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|