Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 1289307..1289883 | Replicon | chromosome |
Accession | NZ_CP106838 | ||
Organism | Klebsiella michiganensis strain K5-3 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | N6B35_RS06065 | Protein ID | WP_080528481.1 |
Coordinates | 1289596..1289883 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A0H3H591 |
Locus tag | N6B35_RS06060 | Protein ID | WP_014227757.1 |
Coordinates | 1289307..1289609 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6B35_RS06045 (N6B35_06045) | 1286146..1286481 | + | 336 | WP_080528483.1 | endoribonuclease SymE | - |
N6B35_RS06050 (N6B35_06050) | 1286935..1287846 | + | 912 | WP_080528482.1 | acetamidase/formamidase family protein | - |
N6B35_RS06055 (N6B35_06055) | 1287843..1289186 | + | 1344 | WP_049101852.1 | APC family permease | - |
N6B35_RS06060 (N6B35_06060) | 1289307..1289609 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
N6B35_RS06065 (N6B35_06065) | 1289596..1289883 | - | 288 | WP_080528481.1 | BrnT family toxin | Toxin |
N6B35_RS06070 (N6B35_06070) | 1290143..1290586 | - | 444 | WP_014227755.1 | FosA family fosfomycin resistance glutathione transferase | - |
N6B35_RS06075 (N6B35_06075) | 1290580..1291488 | - | 909 | WP_049080873.1 | LysR family transcriptional regulator | - |
N6B35_RS06080 (N6B35_06080) | 1291576..1292358 | + | 783 | WP_025108473.1 | NAD(P)H-dependent oxidoreductase | - |
N6B35_RS06085 (N6B35_06085) | 1292506..1293090 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
N6B35_RS06090 (N6B35_06090) | 1293108..1293908 | + | 801 | WP_014227752.1 | winged helix-turn-helix domain-containing protein | - |
N6B35_RS06095 (N6B35_06095) | 1293905..1294423 | + | 519 | WP_064380989.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1278169..1289886 | 11717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11104.61 Da Isoelectric Point: 8.5901
>T259879 WP_080528481.1 NZ_CP106838:c1289883-1289596 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGAYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGAYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|