Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 586963..587582 Replicon chromosome
Accession NZ_CP106838
Organism Klebsiella michiganensis strain K5-3

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag N6B35_RS02840 Protein ID WP_004099646.1
Coordinates 587364..587582 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag N6B35_RS02835 Protein ID WP_025107145.1
Coordinates 586963..587337 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6B35_RS02825 (N6B35_02825) 582119..583312 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N6B35_RS02830 (N6B35_02830) 583335..586481 + 3147 WP_032748290.1 multidrug efflux RND transporter permease subunit AcrB -
N6B35_RS02835 (N6B35_02835) 586963..587337 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
N6B35_RS02840 (N6B35_02840) 587364..587582 + 219 WP_004099646.1 HHA domain-containing protein Toxin
N6B35_RS02845 (N6B35_02845) 587745..588311 + 567 WP_032748289.1 maltose O-acetyltransferase -
N6B35_RS02850 (N6B35_02850) 588283..588417 - 135 WP_223226764.1 hypothetical protein -
N6B35_RS02855 (N6B35_02855) 588438..588908 + 471 WP_014228205.1 YlaC family protein -
N6B35_RS02860 (N6B35_02860) 588883..590337 - 1455 WP_032748288.1 PLP-dependent aminotransferase family protein -
N6B35_RS02865 (N6B35_02865) 590439..591137 + 699 WP_032748285.1 GNAT family protein -
N6B35_RS02870 (N6B35_02870) 591134..591274 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
N6B35_RS02875 (N6B35_02875) 591274..591537 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T259877 WP_004099646.1 NZ_CP106838:587364-587582 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT259877 WP_025107145.1 NZ_CP106838:586963-587337 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References