Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 504746..505426 | Replicon | chromosome |
Accession | NZ_CP106838 | ||
Organism | Klebsiella michiganensis strain K5-3 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | N6B35_RS02425 | Protein ID | WP_263074943.1 |
Coordinates | 504746..505066 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N6B35_RS02430 | Protein ID | WP_263074944.1 |
Coordinates | 505103..505426 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6B35_RS02405 (N6B35_02405) | 499973..502147 | + | 2175 | WP_080528551.1 | extracellular solute-binding protein | - |
N6B35_RS02410 (N6B35_02410) | 502263..502556 | - | 294 | WP_080528550.1 | hypothetical protein | - |
N6B35_RS02415 (N6B35_02415) | 502767..503249 | - | 483 | WP_025107123.1 | hypothetical protein | - |
N6B35_RS02420 (N6B35_02420) | 503799..504632 | - | 834 | WP_263075140.1 | DUF4942 domain-containing protein | - |
N6B35_RS02425 (N6B35_02425) | 504746..505066 | - | 321 | WP_263074943.1 | toxin | Toxin |
N6B35_RS02430 (N6B35_02430) | 505103..505426 | - | 324 | WP_263074944.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N6B35_RS02435 (N6B35_02435) | 505440..505910 | - | 471 | WP_263074945.1 | DNA repair protein RadC | - |
N6B35_RS02440 (N6B35_02440) | 505980..506801 | - | 822 | WP_263074947.1 | DUF932 domain-containing protein | - |
N6B35_RS02445 (N6B35_02445) | 506923..507354 | - | 432 | WP_263075142.1 | IrmA family protein | - |
N6B35_RS02450 (N6B35_02450) | 507372..507824 | - | 453 | WP_234054726.1 | hypothetical protein | - |
N6B35_RS02455 (N6B35_02455) | 507863..508429 | - | 567 | WP_263074948.1 | hypothetical protein | - |
N6B35_RS02460 (N6B35_02460) | 508435..509136 | - | 702 | WP_024484792.1 | WYL domain-containing protein | - |
N6B35_RS02465 (N6B35_02465) | 509349..510224 | - | 876 | WP_263074950.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 503799..529874 | 26075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12034.60 Da Isoelectric Point: 5.9538
>T259876 WP_263074943.1 NZ_CP106838:c505066-504746 [Klebsiella michiganensis]
MHISSVPATVPASSRLSPIQVWQQLLTYLLEHHYGLTLNDTPFHDDTAIQEHIEAGITLADAVNFLVDRYELVRTDRKGF
SWQEQTPFLTATDILRARRATGLMNT
MHISSVPATVPASSRLSPIQVWQQLLTYLLEHHYGLTLNDTPFHDDTAIQEHIEAGITLADAVNFLVDRYELVRTDRKGF
SWQEQTPFLTATDILRARRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|