Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1937590..1938060 Replicon chromosome
Accession NZ_CP106834
Organism Staphylococcus epidermidis strain AH6072

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag N8145_RS09260 Protein ID WP_001829569.1
Coordinates 1937872..1938060 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag N8145_RS09255 Protein ID WP_002438963.1
Coordinates 1937590..1937847 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8145_RS09215 (N8145_09215) 1932954..1933670 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
N8145_RS09220 (N8145_09220) 1933831..1934253 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
N8145_RS09225 (N8145_09225) 1934437..1934574 - 138 WP_162158130.1 hypothetical protein -
N8145_RS09230 (N8145_09230) 1934604..1934791 - 188 Protein_1784 hypothetical protein -
N8145_RS09235 (N8145_09235) 1935178..1935678 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
N8145_RS09240 (N8145_09240) 1935949..1936536 - 588 WP_001829615.1 histidine phosphatase family protein -
N8145_RS09245 (N8145_09245) 1936750..1936986 + 237 WP_002457224.1 hypothetical protein -
N8145_RS09250 (N8145_09250) 1936978..1937181 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
N8145_RS09255 (N8145_09255) 1937590..1937847 + 258 WP_002438963.1 hypothetical protein Antitoxin
N8145_RS09260 (N8145_09260) 1937872..1938060 + 189 WP_001829569.1 hypothetical protein Toxin
N8145_RS09265 (N8145_09265) 1938250..1938804 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
N8145_RS09270 (N8145_09270) 1938864..1939097 - 234 WP_001829664.1 hypothetical protein -
N8145_RS09275 (N8145_09275) 1939381..1940127 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
N8145_RS09280 (N8145_09280) 1940226..1940510 + 285 WP_001829635.1 hypothetical protein -
N8145_RS09285 (N8145_09285) 1940534..1940758 + 225 WP_001829613.1 hypothetical protein -
N8145_RS09290 (N8145_09290) 1941379..1941579 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1872565..1956262 83697
- flank IS/Tn - - 1934437..1934592 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T259873 WP_001829569.1 NZ_CP106834:1937872-1938060 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT259873 WP_002438963.1 NZ_CP106834:1937590-1937847 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References