Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1915922..1916710 Replicon chromosome
Accession NZ_CP106834
Organism Staphylococcus epidermidis strain AH6072

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag N8145_RS09110 Protein ID WP_002484735.1
Coordinates 1916249..1916710 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag N8145_RS09105 Protein ID WP_002498323.1
Coordinates 1915922..1916236 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8145_RS09050 (N8145_09050) 1911107..1911883 - 777 WP_002468156.1 ATP-binding protein -
N8145_RS09055 (N8145_09055) 1911884..1912369 - 486 WP_002498316.1 siphovirus Gp157 family protein -
N8145_RS09060 (N8145_09060) 1912353..1912616 - 264 WP_002468154.1 hypothetical protein -
N8145_RS09065 (N8145_09065) 1912682..1912864 - 183 WP_002498317.1 hypothetical protein -
N8145_RS09070 (N8145_09070) 1912861..1913076 - 216 WP_002468180.1 hypothetical protein -
N8145_RS09075 (N8145_09075) 1913184..1913387 + 204 WP_002468183.1 hypothetical protein -
N8145_RS09080 (N8145_09080) 1913495..1913983 - 489 WP_002498318.1 ORF6C domain-containing protein -
N8145_RS09085 (N8145_09085) 1914042..1914422 + 381 WP_002498319.1 DUF2513 domain-containing protein -
N8145_RS09090 (N8145_09090) 1914414..1914590 - 177 WP_002498320.1 hypothetical protein -
N8145_RS09095 (N8145_09095) 1914601..1915518 - 918 WP_080352717.1 hypothetical protein -
N8145_RS09100 (N8145_09100) 1915533..1915769 - 237 WP_002498322.1 helix-turn-helix transcriptional regulator -
N8145_RS09105 (N8145_09105) 1915922..1916236 + 315 WP_002498323.1 helix-turn-helix transcriptional regulator Antitoxin
N8145_RS09110 (N8145_09110) 1916249..1916710 + 462 WP_002484735.1 ImmA/IrrE family metallo-endopeptidase Toxin
N8145_RS09115 (N8145_09115) 1916879..1917046 + 168 WP_002498324.1 hypothetical protein -
N8145_RS09120 (N8145_09120) 1917068..1918207 + 1140 WP_002498325.1 CapA family protein -
N8145_RS09125 (N8145_09125) 1918423..1919472 + 1050 WP_002498326.1 tyrosine-type recombinase/integrase -
N8145_RS09130 (N8145_09130) 1919540..1920937 - 1398 WP_002498327.1 Fe-S cluster assembly protein SufB -
N8145_RS09135 (N8145_09135) 1921143..1921607 - 465 WP_001831954.1 SUF system NifU family Fe-S cluster assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1872565..1956262 83697


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(33-121)

Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 17881.48 Da        Isoelectric Point: 5.0503

>T259872 WP_002484735.1 NZ_CP106834:1916249-1916710 [Staphylococcus epidermidis]
VGKYEDMLIEHDYIEVIECDNLPKRLSGLWLGDMILINRNLPITSKLETLAEELAHNELTYGNIVDQSSFNHRKFEGYAR
RLAYEKLVPLKDIVKAFLQGIHDLYELANFFEVTEGFVQQSIAHYKQKYGLTTRCGDYVIAFEPLRVFEYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12044.60 Da        Isoelectric Point: 5.7723

>AT259872 WP_002498323.1 NZ_CP106834:1915922-1916236 [Staphylococcus epidermidis]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAFLMGWIEDVEEQPQHRAAHL
DGDLTDEEWQEILDYAEYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References