Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1643462..1644147 Replicon chromosome
Accession NZ_CP106826
Organism Neisseria gonorrhoeae strain 9464

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag ND010_RS08535 Protein ID WP_003689143.1
Coordinates 1643965..1644147 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag ND010_RS08530 Protein ID WP_003691454.1
Coordinates 1643462..1643863 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND010_RS08490 (ND010_08490) 1638875..1639057 - 183 WP_260236894.1 hypothetical protein -
ND010_RS08495 (ND010_08495) 1639197..1639883 - 687 WP_042758540.1 hypothetical protein -
ND010_RS08500 (ND010_08500) 1639952..1640113 - 162 WP_003702497.1 hypothetical protein -
ND010_RS08505 (ND010_08505) 1640110..1640388 - 279 WP_003691529.1 hypothetical protein -
ND010_RS08510 (ND010_08510) 1640541..1640873 - 333 WP_003687946.1 hypothetical protein -
ND010_RS08515 (ND010_08515) 1641014..1641208 - 195 WP_003703103.1 hypothetical protein -
ND010_RS08520 (ND010_08520) 1641420..1642181 + 762 WP_012503753.1 hypothetical protein -
ND010_RS08525 (ND010_08525) 1642695..1643279 - 585 WP_003693477.1 Panacea domain-containing protein -
ND010_RS08530 (ND010_08530) 1643462..1643863 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
ND010_RS08535 (ND010_08535) 1643965..1644147 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
ND010_RS08540 (ND010_08540) 1644317..1645147 - 831 WP_260245424.1 DUF3037 domain-containing protein -
ND010_RS08545 (ND010_08545) 1645410..1646165 - 756 WP_003693472.1 LexA family transcriptional regulator -
ND010_RS08550 (ND010_08550) 1646302..1646487 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
ND010_RS08555 (ND010_08555) 1646576..1646731 + 156 WP_003703527.1 hypothetical protein -
ND010_RS08560 (ND010_08560) 1647071..1647190 + 120 Protein_1670 helix-turn-helix domain-containing protein -
ND010_RS08565 (ND010_08565) 1647293..1648273 + 981 Protein_1671 helix-turn-helix domain-containing protein -
ND010_RS08570 (ND010_08570) 1648243..1648455 - 213 WP_263076999.1 hypothetical protein -
ND010_RS08575 (ND010_08575) 1648353..1648823 + 471 WP_263077037.1 hypothetical protein -
ND010_RS08580 (ND010_08580) 1648715..1649020 - 306 WP_263077000.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1627891..1660924 33033


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259866 WP_003689143.1 NZ_CP106826:c1644147-1643965 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259866 WP_003691454.1 NZ_CP106826:c1643863-1643462 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References