Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1661229..1661914 Replicon chromosome
Accession NZ_CP106824
Organism Neisseria gonorrhoeae strain 9399

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDL70_RS08695 Protein ID WP_003689143.1
Coordinates 1661732..1661914 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDL70_RS08690 Protein ID WP_003691454.1
Coordinates 1661229..1661630 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDL70_RS08650 (NDL70_08650) 1656646..1656828 - 183 WP_003691535.1 hypothetical protein -
NDL70_RS08655 (NDL70_08655) 1656968..1657654 - 687 WP_010357532.1 hypothetical protein -
NDL70_RS08660 (NDL70_08660) 1657723..1657884 - 162 WP_003691530.1 hypothetical protein -
NDL70_RS08665 (NDL70_08665) 1657881..1658156 - 276 WP_151266294.1 hypothetical protein -
NDL70_RS08670 (NDL70_08670) 1658310..1658642 - 333 WP_003695500.1 hypothetical protein -
NDL70_RS08675 (NDL70_08675) 1659188..1659949 + 762 WP_012503753.1 hypothetical protein -
NDL70_RS08680 (NDL70_08680) 1660038..1660382 - 345 WP_229931773.1 hypothetical protein -
NDL70_RS08685 (NDL70_08685) 1660463..1661047 - 585 WP_003693477.1 Panacea domain-containing protein -
NDL70_RS08690 (NDL70_08690) 1661229..1661630 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDL70_RS08695 (NDL70_08695) 1661732..1661914 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDL70_RS08700 (NDL70_08700) 1662084..1662902 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDL70_RS08705 (NDL70_08705) 1663177..1663932 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDL70_RS08710 (NDL70_08710) 1664069..1664254 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDL70_RS08715 (NDL70_08715) 1664343..1664498 + 156 WP_003698902.1 hypothetical protein -
NDL70_RS08720 (NDL70_08720) 1664475..1664663 - 189 WP_003691445.1 hypothetical protein -
NDL70_RS08725 (NDL70_08725) 1664836..1665063 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDL70_RS08730 (NDL70_08730) 1665060..1666022 + 963 WP_229940817.1 helix-turn-helix domain-containing protein -
NDL70_RS08735 (NDL70_08735) 1666038..1666817 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1644901..1679319 34418


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259864 WP_003689143.1 NZ_CP106824:c1661914-1661732 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259864 WP_003691454.1 NZ_CP106824:c1661630-1661229 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References