Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1656103..1656788 Replicon chromosome
Accession NZ_CP106821
Organism Neisseria gonorrhoeae strain 10529

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ80_RS08635 Protein ID WP_003689143.1
Coordinates 1656606..1656788 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ80_RS08630 Protein ID WP_003691454.1
Coordinates 1656103..1656504 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ80_RS08590 (NDQ80_08600) 1651521..1651703 - 183 WP_003691535.1 hypothetical protein -
NDQ80_RS08595 (NDQ80_08605) 1651843..1652529 - 687 WP_010357532.1 hypothetical protein -
NDQ80_RS08600 (NDQ80_08610) 1652598..1652759 - 162 WP_003691530.1 hypothetical protein -
NDQ80_RS08605 (NDQ80_08615) 1652756..1653031 - 276 WP_033911205.1 hypothetical protein -
NDQ80_RS08610 (NDQ80_08620) 1653184..1653516 - 333 WP_003695500.1 hypothetical protein -
NDQ80_RS08615 (NDQ80_08625) 1654062..1654823 + 762 WP_012503753.1 hypothetical protein -
NDQ80_RS08620 (NDQ80_08630) 1654912..1655328 - 417 WP_003700378.1 hypothetical protein -
NDQ80_RS08625 (NDQ80_08635) 1655337..1655921 - 585 WP_003693477.1 Panacea domain-containing protein -
NDQ80_RS08630 (NDQ80_08640) 1656103..1656504 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ80_RS08635 (NDQ80_08645) 1656606..1656788 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ80_RS08640 (NDQ80_08650) 1656958..1657776 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDQ80_RS08645 (NDQ80_08655) 1658051..1658806 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDQ80_RS08650 (NDQ80_08660) 1658943..1659128 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDQ80_RS08655 (NDQ80_08665) 1659217..1659372 + 156 WP_003698902.1 hypothetical protein -
NDQ80_RS08660 (NDQ80_08670) 1659349..1659537 - 189 WP_003691445.1 hypothetical protein -
NDQ80_RS08665 (NDQ80_08675) 1659710..1659937 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDQ80_RS08670 (NDQ80_08680) 1659934..1660446 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
NDQ80_RS08675 (NDQ80_08685) 1660554..1660976 + 423 WP_260244429.1 hypothetical protein -
NDQ80_RS08680 (NDQ80_08690) 1660991..1661770 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1646949..1674253 27304


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259861 WP_003689143.1 NZ_CP106821:c1656788-1656606 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259861 WP_003691454.1 NZ_CP106821:c1656504-1656103 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References