Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 950330..950985 | Replicon | chromosome |
Accession | NZ_CP106821 | ||
Organism | Neisseria gonorrhoeae strain 10529 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ80_RS04910 | Protein ID | WP_003691083.1 |
Coordinates | 950330..950749 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ80_RS04915 | Protein ID | WP_003688410.1 |
Coordinates | 950749..950985 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ80_RS04890 (NDQ80_04905) | 945564..947105 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NDQ80_RS04895 (NDQ80_04910) | 947253..948032 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ80_RS04900 (NDQ80_04915) | 948029..948730 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ80_RS04905 (NDQ80_04920) | 948727..950181 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ80_RS04910 (NDQ80_04925) | 950330..950749 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ80_RS04915 (NDQ80_04930) | 950749..950985 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ80_RS04920 (NDQ80_04935) | 951432..952010 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NDQ80_RS04925 (NDQ80_04940) | 952015..952305 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
NDQ80_RS04930 (NDQ80_04945) | 952655..953041 | + | 387 | Protein_968 | transposase | - |
NDQ80_RS04935 (NDQ80_04950) | 953424..954314 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NDQ80_RS04940 (NDQ80_04955) | 954325..955491 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ80_RS04945 (NDQ80_04960) | 955563..955850 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259860 WP_003691083.1 NZ_CP106821:c950749-950330 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|