Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1630853..1631538 | Replicon | chromosome |
| Accession | NZ_CP106819 | ||
| Organism | Neisseria gonorrhoeae strain 10791 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE39_RS08485 | Protein ID | WP_003689143.1 |
| Coordinates | 1631356..1631538 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE39_RS08480 | Protein ID | WP_003691454.1 |
| Coordinates | 1630853..1631254 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE39_RS08435 (LLE39_08435) | 1626268..1626450 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE39_RS08440 (LLE39_08440) | 1626590..1627276 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE39_RS08445 (LLE39_08445) | 1627345..1627506 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE39_RS08450 (LLE39_08450) | 1627503..1627781 | - | 279 | WP_229930232.1 | hypothetical protein | - |
| LLE39_RS08455 (LLE39_08455) | 1627934..1628266 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE39_RS08460 (LLE39_08460) | 1628407..1628571 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE39_RS08465 (LLE39_08465) | 1628812..1629573 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE39_RS08470 (LLE39_08470) | 1629662..1630078 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE39_RS08475 (LLE39_08475) | 1630087..1630722 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| LLE39_RS08480 (LLE39_08480) | 1630853..1631254 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE39_RS08485 (LLE39_08485) | 1631356..1631538 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE39_RS08490 (LLE39_08490) | 1631708..1632526 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE39_RS08495 (LLE39_08495) | 1632801..1633556 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE39_RS08500 (LLE39_08500) | 1633693..1633878 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE39_RS08505 (LLE39_08505) | 1633967..1634122 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE39_RS08510 (LLE39_08510) | 1634099..1634287 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE39_RS08515 (LLE39_08515) | 1634460..1634687 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE39_RS08520 (LLE39_08520) | 1634684..1635196 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE39_RS08525 (LLE39_08525) | 1635210..1635716 | + | 507 | WP_047920371.1 | hypothetical protein | - |
| LLE39_RS08530 (LLE39_08530) | 1635731..1636510 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1615284..1648623 | 33339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259858 WP_003689143.1 NZ_CP106819:c1631538-1631356 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259858 WP_003691454.1 NZ_CP106819:c1631254-1630853 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|