Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1634896..1635581 | Replicon | chromosome |
| Accession | NZ_CP106817 | ||
| Organism | Neisseria gonorrhoeae strain 10574 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE36_RS08510 | Protein ID | WP_003689143.1 |
| Coordinates | 1635399..1635581 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE36_RS08505 | Protein ID | WP_003691454.1 |
| Coordinates | 1634896..1635297 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE36_RS08460 (LLE36_08460) | 1630314..1630496 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE36_RS08465 (LLE36_08465) | 1630636..1631322 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE36_RS08470 (LLE36_08470) | 1631391..1631552 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE36_RS08475 (LLE36_08475) | 1631549..1631824 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| LLE36_RS08480 (LLE36_08480) | 1631977..1632309 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE36_RS08485 (LLE36_08485) | 1632450..1632614 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE36_RS08490 (LLE36_08490) | 1632855..1633616 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE36_RS08495 (LLE36_08495) | 1633705..1634121 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE36_RS08500 (LLE36_08500) | 1634130..1634765 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| LLE36_RS08505 (LLE36_08505) | 1634896..1635297 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE36_RS08510 (LLE36_08510) | 1635399..1635581 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE36_RS08515 (LLE36_08515) | 1635751..1636569 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE36_RS08520 (LLE36_08520) | 1636844..1637599 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE36_RS08525 (LLE36_08525) | 1637736..1637921 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE36_RS08530 (LLE36_08530) | 1638010..1638165 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE36_RS08535 (LLE36_08535) | 1638142..1638330 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE36_RS08540 (LLE36_08540) | 1638503..1638730 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE36_RS08545 (LLE36_08545) | 1638727..1639194 | + | 468 | WP_229433445.1 | helix-turn-helix domain-containing protein | - |
| LLE36_RS08550 (LLE36_08550) | 1639208..1639738 | + | 531 | WP_229931507.1 | hypothetical protein | - |
| LLE36_RS08555 (LLE36_08555) | 1639753..1640532 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1619331..1652643 | 33312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259856 WP_003689143.1 NZ_CP106817:c1635581-1635399 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259856 WP_003691454.1 NZ_CP106817:c1635297-1634896 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|