Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 651623..652278 | Replicon | chromosome |
Accession | NZ_CP106817 | ||
Organism | Neisseria gonorrhoeae strain 10574 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LLE36_RS03485 | Protein ID | WP_229931500.1 |
Coordinates | 651859..652278 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | LLE36_RS03480 | Protein ID | WP_003688410.1 |
Coordinates | 651623..651859 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLE36_RS03450 (LLE36_03450) | 646758..647045 | + | 288 | WP_003688407.1 | hypothetical protein | - |
LLE36_RS03455 (LLE36_03455) | 647117..648283 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
LLE36_RS03460 (LLE36_03460) | 648294..649184 | + | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
LLE36_RS03465 (LLE36_03465) | 649567..649953 | - | 387 | Protein_676 | transposase | - |
LLE36_RS03470 (LLE36_03470) | 650303..650593 | + | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
LLE36_RS03475 (LLE36_03475) | 650598..651176 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
LLE36_RS03480 (LLE36_03480) | 651623..651859 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
LLE36_RS03485 (LLE36_03485) | 651859..652278 | + | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
LLE36_RS03490 (LLE36_03490) | 652427..653881 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
LLE36_RS03495 (LLE36_03495) | 653878..654579 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
LLE36_RS03500 (LLE36_03500) | 654576..655355 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
LLE36_RS03505 (LLE36_03505) | 655503..657044 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 649501..649974 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T259855 WP_229931500.1 NZ_CP106817:651859-652278 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|