Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1640384..1641069 | Replicon | chromosome |
| Accession | NZ_CP106815 | ||
| Organism | Neisseria gonorrhoeae strain 10562 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | OCL41_RS08555 | Protein ID | WP_003689143.1 |
| Coordinates | 1640887..1641069 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | OCL41_RS08550 | Protein ID | WP_003691454.1 |
| Coordinates | 1640384..1640785 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCL41_RS08510 (OCL41_08510) | 1635802..1635984 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| OCL41_RS08515 (OCL41_08515) | 1636124..1636810 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| OCL41_RS08520 (OCL41_08520) | 1636879..1637040 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| OCL41_RS08525 (OCL41_08525) | 1637037..1637312 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| OCL41_RS08530 (OCL41_08530) | 1637465..1637797 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| OCL41_RS08535 (OCL41_08535) | 1638343..1639104 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| OCL41_RS08540 (OCL41_08540) | 1639193..1639609 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| OCL41_RS08545 (OCL41_08545) | 1639618..1640253 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| OCL41_RS08550 (OCL41_08550) | 1640384..1640785 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OCL41_RS08555 (OCL41_08555) | 1640887..1641069 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OCL41_RS08560 (OCL41_08560) | 1641239..1642057 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| OCL41_RS08565 (OCL41_08565) | 1642332..1643087 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| OCL41_RS08570 (OCL41_08570) | 1643224..1643409 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| OCL41_RS08575 (OCL41_08575) | 1643498..1643653 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| OCL41_RS08580 (OCL41_08580) | 1643630..1643818 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| OCL41_RS08585 (OCL41_08585) | 1643991..1644218 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| OCL41_RS08590 (OCL41_08590) | 1644215..1644682 | + | 468 | WP_229433445.1 | helix-turn-helix domain-containing protein | - |
| OCL41_RS08595 (OCL41_08595) | 1644696..1645226 | + | 531 | WP_229931507.1 | hypothetical protein | - |
| OCL41_RS08600 (OCL41_08600) | 1645241..1646020 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1624819..1658089 | 33270 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259853 WP_003689143.1 NZ_CP106815:c1641069-1640887 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259853 WP_003691454.1 NZ_CP106815:c1640785-1640384 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|