Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1640384..1641069 Replicon chromosome
Accession NZ_CP106815
Organism Neisseria gonorrhoeae strain 10562

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL41_RS08555 Protein ID WP_003689143.1
Coordinates 1640887..1641069 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL41_RS08550 Protein ID WP_003691454.1
Coordinates 1640384..1640785 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL41_RS08510 (OCL41_08510) 1635802..1635984 - 183 WP_003691535.1 hypothetical protein -
OCL41_RS08515 (OCL41_08515) 1636124..1636810 - 687 WP_010357532.1 hypothetical protein -
OCL41_RS08520 (OCL41_08520) 1636879..1637040 - 162 WP_003691530.1 hypothetical protein -
OCL41_RS08525 (OCL41_08525) 1637037..1637312 - 276 WP_033911205.1 hypothetical protein -
OCL41_RS08530 (OCL41_08530) 1637465..1637797 - 333 WP_003695500.1 hypothetical protein -
OCL41_RS08535 (OCL41_08535) 1638343..1639104 + 762 WP_012503753.1 hypothetical protein -
OCL41_RS08540 (OCL41_08540) 1639193..1639609 - 417 WP_003700378.1 hypothetical protein -
OCL41_RS08545 (OCL41_08545) 1639618..1640253 - 636 WP_225602681.1 Panacea domain-containing protein -
OCL41_RS08550 (OCL41_08550) 1640384..1640785 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL41_RS08555 (OCL41_08555) 1640887..1641069 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL41_RS08560 (OCL41_08560) 1641239..1642057 - 819 WP_003693474.1 DUF3037 domain-containing protein -
OCL41_RS08565 (OCL41_08565) 1642332..1643087 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL41_RS08570 (OCL41_08570) 1643224..1643409 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL41_RS08575 (OCL41_08575) 1643498..1643653 + 156 WP_003698902.1 hypothetical protein -
OCL41_RS08580 (OCL41_08580) 1643630..1643818 - 189 WP_003691445.1 hypothetical protein -
OCL41_RS08585 (OCL41_08585) 1643991..1644218 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
OCL41_RS08590 (OCL41_08590) 1644215..1644682 + 468 WP_229433445.1 helix-turn-helix domain-containing protein -
OCL41_RS08595 (OCL41_08595) 1644696..1645226 + 531 WP_229931507.1 hypothetical protein -
OCL41_RS08600 (OCL41_08600) 1645241..1646020 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1624819..1658089 33270


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259853 WP_003689143.1 NZ_CP106815:c1641069-1640887 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259853 WP_003691454.1 NZ_CP106815:c1640785-1640384 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References