Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1642671..1643356 Replicon chromosome
Accession NZ_CP106813
Organism Neisseria gonorrhoeae strain 9431

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL45_RS08565 Protein ID WP_003689143.1
Coordinates 1643174..1643356 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL45_RS08560 Protein ID WP_003691454.1
Coordinates 1642671..1643072 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL45_RS08520 (OCL45_08520) 1638084..1638266 - 183 WP_260236894.1 hypothetical protein -
OCL45_RS08525 (OCL45_08525) 1638406..1639092 - 687 WP_042758540.1 hypothetical protein -
OCL45_RS08530 (OCL45_08530) 1639161..1639322 - 162 WP_003702497.1 hypothetical protein -
OCL45_RS08535 (OCL45_08535) 1639319..1639597 - 279 WP_003691529.1 hypothetical protein -
OCL45_RS08540 (OCL45_08540) 1639750..1640082 - 333 WP_003687946.1 hypothetical protein -
OCL45_RS08545 (OCL45_08545) 1640223..1640417 - 195 WP_003703103.1 hypothetical protein -
OCL45_RS08550 (OCL45_08550) 1640629..1641390 + 762 WP_012503753.1 hypothetical protein -
OCL45_RS08555 (OCL45_08555) 1641904..1642488 - 585 WP_003693477.1 Panacea domain-containing protein -
OCL45_RS08560 (OCL45_08560) 1642671..1643072 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL45_RS08565 (OCL45_08565) 1643174..1643356 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL45_RS08570 (OCL45_08570) 1643526..1644356 - 831 WP_260245424.1 DUF3037 domain-containing protein -
OCL45_RS08575 (OCL45_08575) 1644619..1645374 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL45_RS08580 (OCL45_08580) 1645511..1645696 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL45_RS08585 (OCL45_08585) 1645785..1645940 + 156 WP_003703527.1 hypothetical protein -
OCL45_RS08590 (OCL45_08590) 1646277..1646438 + 162 WP_262347354.1 helix-turn-helix domain-containing protein -
OCL45_RS08595 (OCL45_08595) 1646499..1647485 + 987 Protein_1676 helix-turn-helix domain-containing protein -
OCL45_RS08600 (OCL45_08600) 1647455..1647733 - 279 WP_263055878.1 hypothetical protein -
OCL45_RS08605 (OCL45_08605) 1647767..1647988 - 222 WP_263055879.1 hypothetical protein -
OCL45_RS08610 (OCL45_08610) 1648033..1648266 + 234 WP_263055880.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1627100..1660117 33017


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259850 WP_003689143.1 NZ_CP106813:c1643356-1643174 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259850 WP_003691454.1 NZ_CP106813:c1643072-1642671 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References