Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1658625..1659310 | Replicon | chromosome |
| Accession | NZ_CP106811 | ||
| Organism | Neisseria gonorrhoeae strain 10531 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | OCL46_RS08635 | Protein ID | WP_003689143.1 |
| Coordinates | 1659128..1659310 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | OCL46_RS08630 | Protein ID | WP_003691454.1 |
| Coordinates | 1658625..1659026 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCL46_RS08585 (OCL46_08585) | 1654043..1654225 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| OCL46_RS08590 (OCL46_08590) | 1654365..1655051 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| OCL46_RS08595 (OCL46_08595) | 1655120..1655281 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| OCL46_RS08600 (OCL46_08600) | 1655278..1655553 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| OCL46_RS08605 (OCL46_08605) | 1655706..1656038 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| OCL46_RS08610 (OCL46_08610) | 1656179..1656343 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| OCL46_RS08615 (OCL46_08615) | 1656584..1657345 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| OCL46_RS08620 (OCL46_08620) | 1657434..1657850 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| OCL46_RS08625 (OCL46_08625) | 1657859..1658494 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| OCL46_RS08630 (OCL46_08630) | 1658625..1659026 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OCL46_RS08635 (OCL46_08635) | 1659128..1659310 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OCL46_RS08640 (OCL46_08640) | 1659480..1660298 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| OCL46_RS08645 (OCL46_08645) | 1660573..1661328 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| OCL46_RS08650 (OCL46_08650) | 1661465..1661650 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| OCL46_RS08655 (OCL46_08655) | 1661739..1661894 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| OCL46_RS08660 (OCL46_08660) | 1661871..1662059 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| OCL46_RS08665 (OCL46_08665) | 1662232..1662459 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| OCL46_RS08670 (OCL46_08670) | 1662456..1662968 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| OCL46_RS08675 (OCL46_08675) | 1662982..1663500 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| OCL46_RS08680 (OCL46_08680) | 1663515..1664294 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1642298..1676741 | 34443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259848 WP_003689143.1 NZ_CP106811:c1659310-1659128 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259848 WP_003691454.1 NZ_CP106811:c1659026-1658625 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|