Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1642181..1642866 Replicon chromosome
Accession NZ_CP106809
Organism Neisseria gonorrhoeae strain 10708

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL44_RS08575 Protein ID WP_003689143.1
Coordinates 1642684..1642866 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL44_RS08570 Protein ID WP_003691454.1
Coordinates 1642181..1642582 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL44_RS08530 (OCL44_08530) 1637597..1637779 - 183 WP_260236894.1 hypothetical protein -
OCL44_RS08535 (OCL44_08535) 1637919..1638605 - 687 WP_263055815.1 hypothetical protein -
OCL44_RS08540 (OCL44_08540) 1638674..1638835 - 162 WP_047924242.1 hypothetical protein -
OCL44_RS08545 (OCL44_08545) 1638832..1639107 - 276 WP_003695501.1 hypothetical protein -
OCL44_RS08550 (OCL44_08550) 1639260..1639592 - 333 WP_003687946.1 hypothetical protein -
OCL44_RS08555 (OCL44_08555) 1639733..1639927 - 195 WP_003703103.1 hypothetical protein -
OCL44_RS08560 (OCL44_08560) 1640139..1640900 + 762 WP_012503753.1 hypothetical protein -
OCL44_RS08565 (OCL44_08565) 1641414..1641998 - 585 WP_003693477.1 Panacea domain-containing protein -
OCL44_RS08570 (OCL44_08570) 1642181..1642582 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL44_RS08575 (OCL44_08575) 1642684..1642866 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL44_RS08580 (OCL44_08580) 1643036..1643866 - 831 WP_229505546.1 DUF3037 domain-containing protein -
OCL44_RS08585 (OCL44_08585) 1644129..1644884 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL44_RS08590 (OCL44_08590) 1645021..1645206 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL44_RS08595 (OCL44_08595) 1645295..1645450 + 156 WP_003703527.1 hypothetical protein -
OCL44_RS08600 (OCL44_08600) 1645427..1645615 - 189 WP_003696008.1 hypothetical protein -
OCL44_RS08605 (OCL44_08605) 1645788..1646015 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
OCL44_RS08610 (OCL44_08610) 1646012..1646497 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
OCL44_RS08615 (OCL44_08615) 1646494..1647000 + 507 WP_260236987.1 hypothetical protein -
OCL44_RS08620 (OCL44_08620) 1647014..1647793 + 780 WP_146711208.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1626613..1659627 33014


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259845 WP_003689143.1 NZ_CP106809:c1642866-1642684 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259845 WP_003691454.1 NZ_CP106809:c1642582-1642181 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References