Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 661289..661944 | Replicon | chromosome |
Accession | NZ_CP106809 | ||
Organism | Neisseria gonorrhoeae strain 10708 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | OCL44_RS03540 | Protein ID | WP_003691083.1 |
Coordinates | 661525..661944 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | OCL44_RS03535 | Protein ID | WP_003688410.1 |
Coordinates | 661289..661525 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCL44_RS03505 (OCL44_03505) | 656423..656710 | + | 288 | WP_003688407.1 | hypothetical protein | - |
OCL44_RS03510 (OCL44_03510) | 656782..657948 | + | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
OCL44_RS03515 (OCL44_03515) | 657959..658849 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
OCL44_RS03520 (OCL44_03520) | 659232..659618 | - | 387 | Protein_688 | transposase | - |
OCL44_RS03525 (OCL44_03525) | 659857..660258 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
OCL44_RS03530 (OCL44_03530) | 660263..660841 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
OCL44_RS03535 (OCL44_03535) | 661289..661525 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
OCL44_RS03540 (OCL44_03540) | 661525..661944 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
OCL44_RS03545 (OCL44_03545) | 662093..663547 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
OCL44_RS03550 (OCL44_03550) | 663544..664245 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
OCL44_RS03555 (OCL44_03555) | 664242..665021 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
OCL44_RS03560 (OCL44_03560) | 665169..666710 | + | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259844 WP_003691083.1 NZ_CP106809:661525-661944 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|