Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1642276..1642961 Replicon chromosome
Accession NZ_CP106805
Organism Neisseria gonorrhoeae strain 10743

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL39_RS08545 Protein ID WP_003689143.1
Coordinates 1642779..1642961 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL39_RS08540 Protein ID WP_003691454.1
Coordinates 1642276..1642677 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL39_RS08500 (OCL39_08500) 1637694..1637876 - 183 WP_260236894.1 hypothetical protein -
OCL39_RS08505 (OCL39_08505) 1638016..1638702 - 687 WP_263055815.1 hypothetical protein -
OCL39_RS08510 (OCL39_08510) 1638771..1638932 - 162 WP_047924242.1 hypothetical protein -
OCL39_RS08515 (OCL39_08515) 1638929..1639204 - 276 WP_003695501.1 hypothetical protein -
OCL39_RS08520 (OCL39_08520) 1639357..1639731 - 375 WP_263055814.1 hypothetical protein -
OCL39_RS08525 (OCL39_08525) 1639828..1640022 - 195 WP_003703103.1 hypothetical protein -
OCL39_RS08530 (OCL39_08530) 1640234..1640995 + 762 WP_012503753.1 hypothetical protein -
OCL39_RS08535 (OCL39_08535) 1641509..1642093 - 585 WP_003693477.1 Panacea domain-containing protein -
OCL39_RS08540 (OCL39_08540) 1642276..1642677 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL39_RS08545 (OCL39_08545) 1642779..1642961 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL39_RS08550 (OCL39_08550) 1643131..1643961 - 831 WP_229505546.1 DUF3037 domain-containing protein -
OCL39_RS08555 (OCL39_08555) 1644224..1644979 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL39_RS08560 (OCL39_08560) 1645116..1645301 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL39_RS08565 (OCL39_08565) 1645390..1645545 + 156 WP_003703527.1 hypothetical protein -
OCL39_RS08570 (OCL39_08570) 1645522..1645710 - 189 WP_003696008.1 hypothetical protein -
OCL39_RS08575 (OCL39_08575) 1645883..1646110 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
OCL39_RS08580 (OCL39_08580) 1646107..1646592 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
OCL39_RS08585 (OCL39_08585) 1646589..1647095 + 507 WP_260236987.1 hypothetical protein -
OCL39_RS08590 (OCL39_08590) 1647109..1647888 + 780 WP_263055826.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1626710..1659970 33260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259839 WP_003689143.1 NZ_CP106805:c1642961-1642779 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259839 WP_003691454.1 NZ_CP106805:c1642677-1642276 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References