Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 947962..948617 | Replicon | chromosome |
Accession | NZ_CP106805 | ||
Organism | Neisseria gonorrhoeae strain 10743 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | OCL39_RS04810 | Protein ID | WP_003691083.1 |
Coordinates | 947962..948381 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | OCL39_RS04815 | Protein ID | WP_003688410.1 |
Coordinates | 948381..948617 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCL39_RS04790 (OCL39_04790) | 943196..944737 | - | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
OCL39_RS04795 (OCL39_04795) | 944885..945664 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
OCL39_RS04800 (OCL39_04800) | 945661..946362 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
OCL39_RS04805 (OCL39_04805) | 946359..947813 | + | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
OCL39_RS04810 (OCL39_04810) | 947962..948381 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
OCL39_RS04815 (OCL39_04815) | 948381..948617 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
OCL39_RS04820 (OCL39_04820) | 949065..949643 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
OCL39_RS04825 (OCL39_04825) | 949648..950049 | - | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
OCL39_RS04830 (OCL39_04830) | 950288..950674 | + | 387 | Protein_940 | transposase | - |
OCL39_RS04835 (OCL39_04835) | 951057..951947 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
OCL39_RS04840 (OCL39_04840) | 951958..953124 | - | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
OCL39_RS04845 (OCL39_04845) | 953196..953483 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259838 WP_003691083.1 NZ_CP106805:c948381-947962 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|