Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1643878..1644563 Replicon chromosome
Accession NZ_CP106803
Organism Neisseria gonorrhoeae strain 10819

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL40_RS08550 Protein ID WP_003689143.1
Coordinates 1644381..1644563 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL40_RS08545 Protein ID WP_003691454.1
Coordinates 1643878..1644279 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL40_RS08505 (OCL40_08505) 1639296..1639478 - 183 WP_260236894.1 hypothetical protein -
OCL40_RS08510 (OCL40_08510) 1639618..1640304 - 687 WP_263055815.1 hypothetical protein -
OCL40_RS08515 (OCL40_08515) 1640373..1640534 - 162 WP_047924242.1 hypothetical protein -
OCL40_RS08520 (OCL40_08520) 1640531..1640806 - 276 WP_003695501.1 hypothetical protein -
OCL40_RS08525 (OCL40_08525) 1640959..1641333 - 375 WP_263055814.1 hypothetical protein -
OCL40_RS08530 (OCL40_08530) 1641430..1641624 - 195 WP_003703103.1 hypothetical protein -
OCL40_RS08535 (OCL40_08535) 1641836..1642597 + 762 WP_012503753.1 hypothetical protein -
OCL40_RS08540 (OCL40_08540) 1643111..1643695 - 585 WP_003693477.1 Panacea domain-containing protein -
OCL40_RS08545 (OCL40_08545) 1643878..1644279 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL40_RS08550 (OCL40_08550) 1644381..1644563 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL40_RS08555 (OCL40_08555) 1644733..1645563 - 831 WP_229505546.1 DUF3037 domain-containing protein -
OCL40_RS08560 (OCL40_08560) 1645826..1646581 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL40_RS08565 (OCL40_08565) 1646718..1646903 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL40_RS08570 (OCL40_08570) 1646992..1647147 + 156 WP_003703527.1 hypothetical protein -
OCL40_RS08575 (OCL40_08575) 1647124..1647312 - 189 WP_003696008.1 hypothetical protein -
OCL40_RS08580 (OCL40_08580) 1647485..1647712 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
OCL40_RS08585 (OCL40_08585) 1647709..1648194 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
OCL40_RS08590 (OCL40_08590) 1648191..1648697 + 507 WP_260236987.1 hypothetical protein -
OCL40_RS08595 (OCL40_08595) 1648711..1649490 + 780 WP_263055826.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1628312..1661572 33260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259837 WP_003689143.1 NZ_CP106803:c1644563-1644381 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259837 WP_003691454.1 NZ_CP106803:c1644279-1643878 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References