Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 661144..661799 | Replicon | chromosome |
| Accession | NZ_CP106803 | ||
| Organism | Neisseria gonorrhoeae strain 10819 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | OCL40_RS03510 | Protein ID | WP_003691083.1 |
| Coordinates | 661380..661799 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OCL40_RS03505 | Protein ID | WP_003688410.1 |
| Coordinates | 661144..661380 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCL40_RS03475 (OCL40_03475) | 656278..656565 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| OCL40_RS03480 (OCL40_03480) | 656637..657803 | + | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| OCL40_RS03485 (OCL40_03485) | 657814..658704 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
| OCL40_RS03490 (OCL40_03490) | 659087..659473 | - | 387 | Protein_681 | transposase | - |
| OCL40_RS03495 (OCL40_03495) | 659712..660113 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
| OCL40_RS03500 (OCL40_03500) | 660118..660696 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
| OCL40_RS03505 (OCL40_03505) | 661144..661380 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OCL40_RS03510 (OCL40_03510) | 661380..661799 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OCL40_RS03515 (OCL40_03515) | 661948..663402 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OCL40_RS03520 (OCL40_03520) | 663399..664100 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OCL40_RS03525 (OCL40_03525) | 664097..664876 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| OCL40_RS03530 (OCL40_03530) | 665024..666565 | + | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259836 WP_003691083.1 NZ_CP106803:661380-661799 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|