Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1643910..1644595 | Replicon | chromosome |
| Accession | NZ_CP106801 | ||
| Organism | Neisseria gonorrhoeae strain 10744 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | OCL43_RS08565 | Protein ID | WP_003689143.1 |
| Coordinates | 1644413..1644595 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | OCL43_RS08560 | Protein ID | WP_003691454.1 |
| Coordinates | 1643910..1644311 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCL43_RS08520 (OCL43_08520) | 1639328..1639510 | - | 183 | WP_260236894.1 | hypothetical protein | - |
| OCL43_RS08525 (OCL43_08525) | 1639650..1640336 | - | 687 | WP_263055815.1 | hypothetical protein | - |
| OCL43_RS08530 (OCL43_08530) | 1640405..1640566 | - | 162 | WP_047924242.1 | hypothetical protein | - |
| OCL43_RS08535 (OCL43_08535) | 1640563..1640838 | - | 276 | WP_003695501.1 | hypothetical protein | - |
| OCL43_RS08540 (OCL43_08540) | 1640991..1641365 | - | 375 | WP_263055814.1 | hypothetical protein | - |
| OCL43_RS08545 (OCL43_08545) | 1641462..1641656 | - | 195 | WP_003703103.1 | hypothetical protein | - |
| OCL43_RS08550 (OCL43_08550) | 1641868..1642629 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| OCL43_RS08555 (OCL43_08555) | 1643143..1643727 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| OCL43_RS08560 (OCL43_08560) | 1643910..1644311 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OCL43_RS08565 (OCL43_08565) | 1644413..1644595 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OCL43_RS08570 (OCL43_08570) | 1644765..1645595 | - | 831 | WP_229505546.1 | DUF3037 domain-containing protein | - |
| OCL43_RS08575 (OCL43_08575) | 1645858..1646613 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| OCL43_RS08580 (OCL43_08580) | 1646750..1646935 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| OCL43_RS08585 (OCL43_08585) | 1647024..1647179 | + | 156 | WP_003703527.1 | hypothetical protein | - |
| OCL43_RS08590 (OCL43_08590) | 1647156..1647344 | - | 189 | WP_003696008.1 | hypothetical protein | - |
| OCL43_RS08595 (OCL43_08595) | 1647517..1647744 | + | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| OCL43_RS08600 (OCL43_08600) | 1647741..1648226 | + | 486 | WP_260236988.1 | helix-turn-helix domain-containing protein | - |
| OCL43_RS08605 (OCL43_08605) | 1648223..1648729 | + | 507 | WP_260236987.1 | hypothetical protein | - |
| OCL43_RS08610 (OCL43_08610) | 1648743..1649522 | + | 780 | WP_263055826.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1628344..1661604 | 33260 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259835 WP_003689143.1 NZ_CP106801:c1644595-1644413 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259835 WP_003691454.1 NZ_CP106801:c1644311-1643910 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|