Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1643910..1644595 Replicon chromosome
Accession NZ_CP106801
Organism Neisseria gonorrhoeae strain 10744

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OCL43_RS08565 Protein ID WP_003689143.1
Coordinates 1644413..1644595 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OCL43_RS08560 Protein ID WP_003691454.1
Coordinates 1643910..1644311 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCL43_RS08520 (OCL43_08520) 1639328..1639510 - 183 WP_260236894.1 hypothetical protein -
OCL43_RS08525 (OCL43_08525) 1639650..1640336 - 687 WP_263055815.1 hypothetical protein -
OCL43_RS08530 (OCL43_08530) 1640405..1640566 - 162 WP_047924242.1 hypothetical protein -
OCL43_RS08535 (OCL43_08535) 1640563..1640838 - 276 WP_003695501.1 hypothetical protein -
OCL43_RS08540 (OCL43_08540) 1640991..1641365 - 375 WP_263055814.1 hypothetical protein -
OCL43_RS08545 (OCL43_08545) 1641462..1641656 - 195 WP_003703103.1 hypothetical protein -
OCL43_RS08550 (OCL43_08550) 1641868..1642629 + 762 WP_012503753.1 hypothetical protein -
OCL43_RS08555 (OCL43_08555) 1643143..1643727 - 585 WP_003693477.1 Panacea domain-containing protein -
OCL43_RS08560 (OCL43_08560) 1643910..1644311 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OCL43_RS08565 (OCL43_08565) 1644413..1644595 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OCL43_RS08570 (OCL43_08570) 1644765..1645595 - 831 WP_229505546.1 DUF3037 domain-containing protein -
OCL43_RS08575 (OCL43_08575) 1645858..1646613 - 756 WP_003693472.1 LexA family transcriptional regulator -
OCL43_RS08580 (OCL43_08580) 1646750..1646935 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OCL43_RS08585 (OCL43_08585) 1647024..1647179 + 156 WP_003703527.1 hypothetical protein -
OCL43_RS08590 (OCL43_08590) 1647156..1647344 - 189 WP_003696008.1 hypothetical protein -
OCL43_RS08595 (OCL43_08595) 1647517..1647744 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
OCL43_RS08600 (OCL43_08600) 1647741..1648226 + 486 WP_260236988.1 helix-turn-helix domain-containing protein -
OCL43_RS08605 (OCL43_08605) 1648223..1648729 + 507 WP_260236987.1 hypothetical protein -
OCL43_RS08610 (OCL43_08610) 1648743..1649522 + 780 WP_263055826.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1628344..1661604 33260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259835 WP_003689143.1 NZ_CP106801:c1644595-1644413 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259835 WP_003691454.1 NZ_CP106801:c1644311-1643910 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References