Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 2701031..2701563 | Replicon | chromosome |
Accession | NZ_CP106793 | ||
Organism | Streptomyces sp. HUAS 13-4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N8I84_RS12610 | Protein ID | WP_263229609.1 |
Coordinates | 2701031..2701294 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N8I84_RS12615 | Protein ID | WP_263229610.1 |
Coordinates | 2701291..2701563 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I84_RS12595 (N8I84_12595) | 2697223..2698836 | + | 1614 | WP_263229607.1 | MFS transporter | - |
N8I84_RS12600 (N8I84_12600) | 2698959..2699414 | + | 456 | WP_200417762.1 | archease | - |
N8I84_RS12605 (N8I84_12605) | 2699460..2700872 | - | 1413 | WP_263229608.1 | RtcB family protein | - |
N8I84_RS12610 (N8I84_12610) | 2701031..2701294 | - | 264 | WP_263229609.1 | Txe/YoeB family addiction module toxin | Toxin |
N8I84_RS12615 (N8I84_12615) | 2701291..2701563 | - | 273 | WP_263229610.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N8I84_RS12620 (N8I84_12620) | 2701945..2703126 | - | 1182 | WP_263229611.1 | acyltransferase | - |
N8I84_RS12625 (N8I84_12625) | 2703372..2704367 | - | 996 | WP_263229612.1 | NADPH:quinone oxidoreductase family protein | - |
N8I84_RS12630 (N8I84_12630) | 2704403..2705167 | - | 765 | WP_263229613.1 | SDR family oxidoreductase | - |
N8I84_RS12635 (N8I84_12635) | 2705201..2705689 | - | 489 | WP_263229614.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10480.82 Da Isoelectric Point: 7.2010
>T259832 WP_263229609.1 NZ_CP106793:c2701294-2701031 [Streptomyces sp. HUAS 13-4]
VRDVNFDPGAWDDFQYWLETDRKMVRRVVRLIGEIQRDPFNGIGKPEPLKGDLSGYWSRRVDDEHRLVYRVDDKEVKILK
ARYHYAD
VRDVNFDPGAWDDFQYWLETDRKMVRRVVRLIGEIQRDPFNGIGKPEPLKGDLSGYWSRRVDDEHRLVYRVDDKEVKILK
ARYHYAD
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|