Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2198505..2199190 | Replicon | chromosome |
| Accession | NZ_CP106789 | ||
| Organism | Neisseria gonorrhoeae strain 10638 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE37_RS11515 | Protein ID | WP_003689143.1 |
| Coordinates | 2199008..2199190 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE37_RS11510 | Protein ID | WP_003691454.1 |
| Coordinates | 2198505..2198906 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE37_RS11465 (LLE37_11465) | 2193920..2194102 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE37_RS11470 (LLE37_11470) | 2194242..2194928 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| LLE37_RS11475 (LLE37_11475) | 2194997..2195158 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE37_RS11480 (LLE37_11480) | 2195155..2195433 | - | 279 | WP_229930232.1 | hypothetical protein | - |
| LLE37_RS11485 (LLE37_11485) | 2195586..2195918 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE37_RS11490 (LLE37_11490) | 2196059..2196223 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE37_RS11495 (LLE37_11495) | 2196464..2197225 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE37_RS11500 (LLE37_11500) | 2197314..2197730 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE37_RS11505 (LLE37_11505) | 2197739..2198323 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| LLE37_RS11510 (LLE37_11510) | 2198505..2198906 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE37_RS11515 (LLE37_11515) | 2199008..2199190 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE37_RS11520 (LLE37_11520) | 2199360..2200178 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE37_RS11525 (LLE37_11525) | 2200453..2201208 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE37_RS11530 (LLE37_11530) | 2201345..2201530 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE37_RS11535 (LLE37_11535) | 2201619..2201774 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE37_RS11540 (LLE37_11540) | 2201751..2201939 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE37_RS11545 (LLE37_11545) | 2202112..2202339 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE37_RS11550 (LLE37_11550) | 2202336..2202848 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE37_RS11555 (LLE37_11555) | 2202862..2203380 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| LLE37_RS11560 (LLE37_11560) | 2203395..2204174 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2182174..2204174 | 22000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259831 WP_003689143.1 NZ_CP106789:c2199190-2199008 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259831 WP_003691454.1 NZ_CP106789:c2198906-2198505 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|