Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1518941..1519596 | Replicon | chromosome |
| Accession | NZ_CP106789 | ||
| Organism | Neisseria gonorrhoeae strain 10638 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | LLE37_RS07975 | Protein ID | WP_003691083.1 |
| Coordinates | 1518941..1519360 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | LLE37_RS07980 | Protein ID | WP_003688410.1 |
| Coordinates | 1519360..1519596 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE37_RS07955 (LLE37_07955) | 1514175..1515716 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
| LLE37_RS07960 (LLE37_07960) | 1515864..1516643 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| LLE37_RS07965 (LLE37_07965) | 1516640..1517341 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| LLE37_RS07970 (LLE37_07970) | 1517338..1518792 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| LLE37_RS07975 (LLE37_07975) | 1518941..1519360 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| LLE37_RS07980 (LLE37_07980) | 1519360..1519596 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| LLE37_RS07985 (LLE37_07985) | 1520043..1520621 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
| LLE37_RS07990 (LLE37_07990) | 1520626..1521027 | - | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
| LLE37_RS07995 (LLE37_07995) | 1521266..1521652 | + | 387 | Protein_1553 | transposase | - |
| LLE37_RS08000 (LLE37_08000) | 1522035..1522925 | - | 891 | WP_229930257.1 | succinate--CoA ligase subunit alpha | - |
| LLE37_RS08005 (LLE37_08005) | 1522936..1524102 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| LLE37_RS08010 (LLE37_08010) | 1524174..1524461 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259830 WP_003691083.1 NZ_CP106789:c1519360-1518941 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|