Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 77741..78266 | Replicon | plasmid pKP1161-1 |
Accession | NZ_CP106787 | ||
Organism | Klebsiella pneumoniae strain KP1161 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A6S4YF27 |
Locus tag | N9H76_RS26390 | Protein ID | WP_025714517.1 |
Coordinates | 77741..78046 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | N9H76_RS26395 | Protein ID | WP_001568025.1 |
Coordinates | 78048..78266 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9H76_RS26360 (N9H76_26360) | 73404..74030 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
N9H76_RS26365 (N9H76_26365) | 74027..74329 | + | 303 | WP_071571079.1 | hypothetical protein | - |
N9H76_RS26370 (N9H76_26370) | 74817..75611 | - | 795 | WP_004197635.1 | site-specific integrase | - |
N9H76_RS26375 (N9H76_26375) | 75809..76825 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
N9H76_RS26380 (N9H76_26380) | 76836..77150 | - | 315 | WP_053389906.1 | hypothetical protein | - |
N9H76_RS26385 (N9H76_26385) | 77177..77572 | - | 396 | WP_017899885.1 | hypothetical protein | - |
N9H76_RS26390 (N9H76_26390) | 77741..78046 | - | 306 | WP_025714517.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
N9H76_RS26395 (N9H76_26395) | 78048..78266 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
N9H76_RS26400 (N9H76_26400) | 78846..79415 | + | 570 | WP_016162066.1 | hypothetical protein | - |
N9H76_RS26405 (N9H76_26405) | 79556..80584 | + | 1029 | WP_001568023.1 | Abi family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrB4 / blaDHA-1 / sul1 | - | 1..115363 | 115363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11562.25 Da Isoelectric Point: 5.6906
>T259829 WP_025714517.1 NZ_CP106787:c78046-77741 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6S4YF27 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |